ELF@@8@@@@PPP<<ff   >>^nn8)k   @QQQPPRtd   >@PtdXXXLLQtdStd hhh88 /system/bin/linker64AndroidGNU-$dX%zJLGNU +3;BINV]dlw} &2BQ]bpw"(/6?HT\ckt{":R\fqv'2<FU\cglsz +3<DJS[emv *6>HQ\gq} !-5?EPV_fpz#+29AHR[agmu    + 8 D S [ c h p x ~                , @ [ f z                   % 0 8 D O f }               " / ; C J Q W \ b n z             0 0 07q   c  >i ! ?i ( @i / `__libc_init__stack_chk_fail__strchr_chk_ctype_strncmpstrtodstrtolfreememmovestrchrstrlen__errno__openat_2closeclosedirfdopendirfstatatmemcpymemsetopendirreaddirreadlinkatstrcpychdirenvirongetenvmemcmpsetenvfprintf__ctype_get_mb_cur_max__read_chk__readlinkat_chk__umask_chk__vsnprintf_chk__vsprintf_chk__write_chkatoiclock_gettimefchmodfchmodatfchownfclosefflushfreadfstatgetdelimgetgrgid_rgetpwuid_risattylocaltimelseekmkdiratnanosleepopenprintfputcputcharreadregexecsscanfstatstderrstdinstdoutstrcmpstrerrorstrftimestrncasecmpstrrchrstrstrstrtolltowlowerunlinkvfprintfwcrtombfopenfputsfwritegetlinewcwidthbindconnectfcntlfreeaddrinfogai_strerrorgetaddrinfoinet_ntoppollrecvfromsendtosetsockoptshutdownsocket__libc_current_sigrtmax__libc_current_sigrtminendmntentfgetxattrflistxattrforkfsetxattrgetmntentgetxattrinotify_add_watchinotify_initioctllgetxattrlistxattrllistxattrlsetxattrsetmntentsetxattrstatvfsstpcpystrcasecmp__open_2_exitcfmakerawcfsetspeedtcgetattrtcsetattr__readlink_chkaccesschrootdupdup2execvpfdopenferrorfputcgetcwdgetgrgidgetgrnamgetpidgetpwnamgetpwuidkilllocaltime_rmallocmkstempmktimemmappipeputsreallocregcompregerrorrenamesetsidsigactionsiglongjmpstrndupstrptimestrtoultzsetunsetenvvprintfvsnprintfwaitpidbasenamenewlocalenl_langinforeadlinksetlocalesetvbufsignaluselocalechmodgzclosegzdirectgzdopengzerrorgzreadgzwriteutimensat__get_h_errnogethostbynamegethostnamehstrerrorsethostnamestrcspnMD5_FinalMD5_InitMD5_UpdateSHA1_FinalSHA1_InitSHA1_UpdateSHA224_FinalSHA224_InitSHA224_UpdateSHA256_FinalSHA256_InitSHA256_UpdateSHA384_FinalSHA384_InitSHA384_UpdateSHA512_FinalSHA512_InitSHA512_Updatemkdtemptcsendbreaksetpgidtcsetpgrpvforkgetfileconlstatpathconfstatfssetitimerftruncatefeoffgetcfscanffseekungetcexitfsyncgettimeofdaybsearchqsortregfreegetopt_longgetopt_long_onlyoptargopterroptindoptoptmemchrfaccessatfchownatfutimensgeteuidlchownlinkatmknodatopenatsymlinkatunlinkatmkdirmknodrmdirsymlinksettimeofdaytimedirname__memcpy_chkfchdirfnmatchsysconfstrcasestrgetcongetegidgetgidgetgrouplistgetgroupsgetuidis_selinux_enabledstrduplink__fwrite_chk__strcat_chk__strlen_chklgetfileconsetfscreatecondprintfstrtoldatofstrncpystrnlenuname__memmove_chkiswspacewaitatolatollget_sched_policyget_sched_policy_namegetsidmemccpysetbufsigsetjmpsysinfosyscallsecurity_getenforcemunmapsecurity_load_policy__android_log_writeselinux_android_restoreconsetexecconsecurity_setenforcectimeklogctlsleepmountsyncumount2__strrchr_chkfgetsinet_ntoainet_ptonstrsep__strcpy_chkacceptalarmgetsocknamelistengetnameinfogetservbyport__cmsg_nxthdrgetifaddrsrecvmsglsetfileconsetfileconsched_get_priority_maxsched_get_priority_minsched_getparamsched_getschedulersched_setschedulerposix_fallocateflockfdatasyncdaylightgmtime_rtimezoneinotify_rm_watchstrtokchownmemmemdaemonmlockalllremovexattrremovexattrswapoffswaponfilenoftellgetcraisecfgetispeedcfgetospeedcfsetispeedcfsetospeedinet_atoniconviconv_opennicegetprioritysetprioritywait4ttynamegetppidprlimitliblog.soLIBLOGlibselinux.soLIBSELINUX_Rlibc.soLIBCLIBC_NLIBC_OLIBC_Plibcrypto.solibz.solibprocessgroup.solibm.solibdl.soAPS233   (&'((())      0 UUUUUUUUUUUUUUUUBm۶۶m۶m۶۶m۶m۶۶UUUUUUUUJU_B!BB!0UU$I$$UEUUUUUUUUUUUUUUUUUUUUUUUUUUUU׀n3swwwwwwnݻwwwwwwwwnݻwwwwswwwݻwwwww7UUEUUUUUUUUUUUUUUUUUUUUUUUUUU߶m۶mUUUU U(U0U 8U @UHU PUXU `UhUpUxUUUUUUU UUU8UJUBUU$U3U4U=V#VGVVH VK(VF0VE8V<@VAHVDPV-XV:`V5hV6pV(xV'V)VIV+V,V7V9V!V%V"V0V/V V;V.V*V&W2WCWPWN WM(W]0WS8W[@WVHWUPWTXWQ`WRhWXpW\xWWWZWcWnWeWpWqW`WhWgWaWbWdWrW_W^WiX1XsXXv Xw(Xu0Xx8Xt@XHXPXXX`XhXpXxXXXX~XX|X}XXXXXLXXXXXYYyYY Y(Y0Y8Y@YHYPYXY`YhYpYxYYYYYYYYYYYYYYYYYZZZOZ Z(Z0Z8Z@ZHZPZXZ`ZhZpZxZZzZZZZZZZZZZZZZZZ[[[[ [([0[8[@[H[P[X[`[h[p[x[[[[[[[[[[[[[[[[[\\\\  \ (\ 0\ 8\ @\H\P\X\`\h\p\x\\\\\\\\\\\\ \!\#\"\$\%]&]'])], ]*(](0]+8]/@]1H]0P].X]-`]2h]3p]5x]6]4]{]<]:]9]=];]>]?]@]D]E]F]G]I]H^L^M^N^P ^O(^Q0^T8^U@^RH^SP^VX^Y`^Xh^Wp^Yx^Z^[^\^]^^^_Q< @ `    <Q  C4CCCC:CC-%c > %lf%s '%s' %*c%s%s%sarmhexagonpariscxpollTTIN[%s?p#v#R<1>3t*>2al>0AaKOHk*o*p*u*s#<1=7d%<100=3000m#n#<1bqkillall>2S(sizelimit)#s(show)ro#j:fdcaD[!afj]<2>4m(mode):Z:ncpkillpmapk(sort)*P(ppid)*aAdeflMno*O*p(pid)*s*t*Tu*U*g*G*wZ[!ol][+Ae][!oO]fiRrv[-fi]rmdirstringsoamvrns[+os]unlink %sif=stdout\%.3oUnexpected end of input<[:punct:]%s%c%s not [+-]N_POSIX_MONOTONIC_CLOCKCHILD_MAX%s needs a path'%s' -> '%s' %F %H:%M%.3sPWD:btTqQ.=:%b.tar.xzTAR_GNAMEbad -gPID,TID,SCHEDUNAMECPUReal (before suid) user IDTIMETIME+%lld/stat%d Buffers: Process attribute field types: %s on %s type %s (%s) infiniband%*s %sActive UNIX domain sockets (%s) :*DISCONNECTINGgetifaddrswlanpid %ld's current scheduling priority: %d SMBus Quick CommandVerity%s: not found [anon] load average: %.02f, %.02f, %.02f /proc/uptimeIPv4SOCK_DIAGKOBJECT_UEVENT%.*s"%s" There are %d section headers, starting at offset %#llx: Section Headers: [Nr] %-20s %-14s %-*s %-6s %-6s ES Flg Lk Inf Al INITFIRST [%6tx] x(RELA)b(RELASZ)Bad note bounds %lu/%lu NT_FPREGSETispeedinvalid arg: %s-echonlquitignbrkxcaseUse%characterdex PKbzip2 compressed data, block size = %c00k LSB nohup.outUnknown option '%s'u%4x%nmicroblaze/proc/mounts[3~[5~readstrtod %sacpichattrgetenforcei2cdump<1cdDpsvt:m:o:g:lognamelp*tmount<1so:xrevt:an#=4<1fovconfig--helpbad -snoxfernotrunc "\>=too many argsbcdlpfs_POSIX_MEMLOCK_RANGE_POSIX_OPEN_MAXWORD_BIT%ld %s%s%s%csymbolichard-pre.tar.gz.txzPID,ADDRCPU time (high precision)Android scheduling policy%lld/%s%d:%dMemTotal:Couldn't get enforcing status/etc/fstab%s needs argumentInfiniBandaddr[NOT SET]GlobalLOOPBACK/proc/net/unix%lu packets transmitted, %lu received, %ld%% packet loss gps/sys/class/rfkill/rfkill%u/uevent/dev/net/tunf2fsxiafs/etc/adjtime 0 1 2 3 4 5 6 7 8 9 a b c d e f 0123456789abcdefdriver%s/ueventdisableNeeds 1 argup %d week%s, %d day%s, %d hour%s, %d minute%s %d user%s, Offset Hex dump of section '%s': b(RELENT)OwnerAndroidNT_PRPSINFONT_X86_XSTATE%s = %s;TIOCGWINSZ %sispeed %d baud; ospeed %d baud;-echoprttandem-hupcrtsctssetsockopt RAW_CHECKSUMbad address: %s %d bytes to %s fifocolor RGBA(bad arch %d) , midi textLinux perf datasetpriority %dReal time (s): %f System time (s): %f User time (s): %f Max RSS (KiB): %ld Major faults: %ld Minor faults: %ld File system inputs: %ld File system outputs: %ld Voluntary context switches: %ld Involuntary context switches: %ld /.%s=%s%lld < %lldU%6x%n (%c/%c):oguppcxnotify_add overflowRTMAX-%daffsTERM%C%y%m%d%H%Mdiw#<0=76[!dw]<1>2ls(silent)(quiet)[!ls]^i0u*?^HL[-HL]gunziplspciprlimit>0LP[-LP]rtcwakesetfattrset speed---%s \ No newline at end of file %.*sno OPTSTRset2 can't be empty string-t '%s'mkdir %s070701%08X%08X%08X%08X%08X%08X%08X%08X%08X%08X%08X%08X%08X_POSIX_FSYNCPOSIX2_FORT_DEVPOSIX2_PBSLOGIN_NAME_MAX_POSIX_RE_DUP_MAXMiscno such user '%s'getgroupsu2:%02d'%s' file is the archive; not dumpedrebad -pPR,NI,VIRT,RES,SHR,S,PCPUUIDS Uid:%*s %256s %d %*s %*sTasksecurity_load_policy %sInvalid state: %sLocal LoopbackMaskPOINTOPOINTALLMULTIframe-s must be provided if using -U with -L/-l/proc/net/tcp%5d %-5d %6d %s %-10s %-11ldlist/bin/shno PRIORITYToybox %s command helpblock devicedaemonizepswpin FileSizLibrary soname 0x%08lx No shdr %d x(FINI_ARRAY)cr0-prteraseolcucvt1can't set multicast source interface %u.%03u ms !I !T%zu/%zuC %zu%% %d,%d%s.swpSu Mo Tu We Th Fr Sa (bad class %d) locked memory (KiB)-%c/proc/%u/exe%ualphamn10300s390KILLPIPEexec %sCan't stat %s[diffw#<0=75hwclock?O:afnrvwt:o*[-rw]nicepatch<1>2no .gz: %siflagExpected ) but got %scontext{}_POSIX_SS_REPL_MAX_POSIX_THREAD_PRIO_INHERIT_POSIX_THREAD_ROBUST_PRIO_PROTECT_POSIX_TRACEPOSIX2_LOCALEDEFPOSIX2_PBS_CHECKPOINTNGROUPS_MAXPRIO_IO_POSIX_MAX_INPUTCHAR_MAXtbad -A '%c'nulsohstxetxeotenqackbel bs ht nl vt ff cr so sidledc1dc2dc3dc4naksynetbcan emsubesc fs gs rs us spaiqQr=%ld%9lld -> %schown %d:%d '%s'ARGSRSS as % of physical memoryDisk I/Owchar:cachedfailed to %s %d's affinity/dev/kmsgklogctldiratimebad name %sActive Internet connections (%s) /proc/net/routeLISTENraw from %s (%s) --- %s ping statistics --- Hard blocked: %s UU%-50s EncryptedExtentsModule%s "%s" "%s" "%s"total% *lld%sSystem time: %lld / %sWARNING: VLAN 1 does not work with many switches. Successful %s on device %s %*lupgpgin %.*s%s *** %s: directory *** Number of program headers: %d Elf file type is %s Entry point %#x There are %d program headers, starting at offset %lld x(TLSDESC_PLT)HIDDENNT_ARM_SVE-icrnl-nl-onlretbs0-ofdelstopcr3, %ld hops max, %u byte packets -- INSERT --Filesystem%u%nGIF87agzip compressed data, flac audio(bad type %d), BuildID=-%02xm32ropenriscs390-oldcramfsbad user '%s'short %s%2u%n:%2u%n<1bhLs[!hL]fmti2cdetectkillnbd-clientsed?fc-n-[-cn]>2n^E:P#<0=1optrn#<1(max-args)s#0[!0E]yesgzclosecount=File %s is not a regular file or directory and was skipped regular file@@ -%ld@@ %sreverse colating ordermodemkpath '%s'bad -%cxdevbad -printf %%T: %%T%cbad arg '%s'_POSIX_SHARED_MEMORY_OBJECTSPOSIX2_PBS_ACCOUNTING_XOPEN_ENH_I18NIOV_MAX_POSIX_TZNAME_MAXUCHAR_MAX%03o*ld%sshort write.tar.bzfDPriority (dynamic 0 to 139)User idSHRirq[%dHgetdefisvwnosuidrelatimetrying BLKROSET ioctl on '%s' ether/proc/net/devMASTER/proc/net/udp6FIN_WAIT2PACKETCONNECTED%-19.19s need root for -i <200 Soft blocked: %s charge_nowon/dev/memUnknown command '%s'bad args %02xI2C Read Block%c %o %63s %63s %u %u %u %u %u.koremprocs_blocked # file: %s %-9s %5d %10.10s %4s%c%c %7s %18s %9s %10s %s --More--(Next file: %s)littleno settings with -a/-gistrip-opostparmrk from %s !V?1049h-%d%s %s%s%s %s %lu%s%s , pcm audiobad suffixprocesses%sx%2x%nopenrisc-oldxtensa-oldU+%04XbfssquashfsILL%n[%n%3u%n;%n%3u%nR%n[15~mmapXXXXXX%Y-%m-%d %TUTC%c%02d:%02dtoyboxegrepinstalllsmodmicrocommkfifo>1(tmpdir);:uqd(directory)p:t(null)0pwd<1(dyn-syms)adehlnp:SsWx:top^<1n%<100=2000tebxconv--- %s '%s' is a directory %F[%s] %sPOSIX2_VERSIONEXPR_NEST_MAXUIO_MAXIOV_POSIX_NAME_MAX_POSIX_SEM_NSEMS_MAXBinary file %s matches %u euid= egid=CSIL%.*Lepatching %s abcirtTqQw:xzTAR_SIZE=%lldEOFCThread name (/proc/TID/stat:2)DWRITE%lld/statm?25l MemFree:-a with >1 argnoauto'%s' is read-only BROADCASTForeign Address:%uCONNECTINGKernel bug workaround: echo 0 99999999 | sudo tee /proc/sys/net/ipv4/ping_group_range Adapter %d: %s-line max_state'%s' to %sSCHED_IDLEmode too longBest-effortvendorrootdir = %s bad -p '%.*s' %*d: %8x%8x%8x%8x:%x %8x%8x%8x%8x:%x %x %*x:%*x %*X:%*X %*X %*d %*d %ld%*p: %*X %*X %*X %*X %*X %lu %nDMmodules.dep Start of section headers: %llu (bytes into file) Section header string table index: %d STATIC_TLSicrnlevenpparodd%d %d onlcr%s isn't a booleanigncriuclcIPV6_TCLASS %ld failed yunknown format %dEFI bootAndroid sparse image v%d.%d, %d %d-byte blocks (%d chunks) #!relocatable, dynamic (%.*s)%llu.%lluarcv2tilegxx86-64btrfsUSR1TSTPxdupxwritebad group '%s'Unknown suffix '%s'(quiet)(no-preserve-owner)md(make-directories)uH:p|i|t|F:v(verbose)o|[!pio][!pot][!pF]fallocatefsync<1>1d:mknodnproc<1>1m#t#<0>255=64c#<0=3s#<0>4064=56i%W#<0=3w#<0qf46I:[-46]^<1wcd[!dc]sha384sumsortswapofff#s#w#zicdutmp.XXXXXXXXXX%s: seek failedibs=none^?Max 2 argumentschown '%s'-D '%s'noleaf_XOPEN_CRYPTBC_SCALE_MAXSEM_VALUE_MAX_POSIX_PIPE_BUF_POSIX_THREAD_DESTRUCTOR_ITERATIONSPOSIX2_BC_DIM_MAX%s : [%d;%dmrzbad -tf '%d'Removing DOS newlines }:././@LongLinkbad (bad -oRSSMINFLRTPRIOGroup IDCPU time consumedPercentage of CPU time usedData read SwapTotal: SwapFree:Needs 2 argsnewbad -p '%s'promiscpointopoint/proc/net/udp PID/Program Name wimaxfmcharge_fullSEC_TYPE%02X%02X-%02X%02XSCHED_BATCH %-32s %s %s: [%lld]:%llu (%s)No_COW, LABEL=%s/proc/%ld/ns/%s%llx-%llx %s %*s %*s %*s %nSwap: %lld% 7lld %7lld %7lld /sys/power/state = VLAN_PLUS_VID_NO_PADsocketISCSIIP6_FWqueuing %s %02d TEXTRELCORE (Core file)EXIDXb(RELSZ)R(RUNPATH)b(RELRENT)FUNCNT_PLATFORMNT_AUXV-ignbrk-ignparocrnlunable to perform all requested operations on %s-olcuccbreak-ctlechoeraseweraseixanycr2traceroute6 to %s(%s)%B %YJava class file, version %d.%d (Java 1.%d) POSIX(bad type %d) TrueType font collection, version %d, %d fonts console%%7ll%c pending signalss%s: created directory '%s' -USR2CONTwritechdir '%s'bad regex '%s': %sTZblkdiscardblockdevchrtdateechoexprfalse?s:ilqvwj#vw#<1=16N#xsodcbA:t*<1xqrealpathrmmod<4>4hn:|v:x:|[!xv]toybox %s %.*sll%cstatus=security.TRAILER!!!dhmsn\;POSIX2_FORT_RUNRTSIG_MAXPTHREAD_STACK_MIN_POSIX_DELAYTIMER_MAX_POSIX_THREAD_KEYS_MAX_POSIX_TIMER_MAXSCHAR_MINundefinedPOSIXLY_CORRECT=1autolu-+Possibly reversed hunk %d at %ld {dDgGhHlnNpPx=\%03oUnknown key option.seek failed-obad -UMajor page faultsCommand line (argv[])STATrchar:defaultssuidmoveIPv6-in-IPv4Memory:%lx-%lx listenProto Recv-Q Send-Q %*s %*s State Local Address[0000]:onlineSCHED_OTHERSCHED_RRpid %ldi2c-%d%s %-10s %-32s %s i2cSMBus Send ByteFunctionalities implemented by %s: /dev/loop-controlSynchronous_Updates%u: %s /proc/sysAUDITmodules.aliasoptionsSize %-14s 0x%06llx 0x%0*llx 0x%0*llx 0x%05llx 0x%05llx %c%c%c %#llx Name/Value Displaying notes found at file offset 0x%llx with length 0x%llx: GNU_STACKx(HASH)b(RELAENT)d(VERDEFNUM)GNU-evenpechokprterasetab1 *yykSVR4 with no CRC%s tar archive%s ADPCMGUIAndroid Binary XML v%d ia64bad %snilfsxmalloc(%ld)No file %ssmhd>2h<1>1f|u|[!fu]>1ZnGgru[!ZGgu]losetup<1Z:m:mkswapunlink%02x File: %N Size: %s Blocks: %b IO Blocks: %B %F Device: %Dh/%dd Inode: %i Links: %h Device type: %t,%T Access: (%04a/%A) Uid: (%5u/%8U) Gid: (%5g/%8G) Access: %x Modify: %y Change: %zregular empty file'%s' to '%lld'seek=%lldempty ( )[:alnum:]NULL%s %s differ: char %ld, line %ld 070701%040X%056X%08XTRAILER!!!deletenotandprint0_POSIX_TRACE_EVENT_FILTER_POSIX_VERSION_POSIX_V7_LP64_OFF64_XOPEN_VERSIONOPEN_MAXTIMER_MAX_POSIX_ARG_MAX_POSIX_MAX_CANON_POSIX_STREAM_MAX%s_XXXXXX% *d,% 4drnmkpath %srm /. if you mean itbad -P%cID,USER,%s%%CPU,%%MEM,TIME+,%sNIVirtual memory sizeData I/O%lld/iowrite_bytes:%lld/exeSwapNot int %s/proc/%ld/task/%u Invalid signalSignal %s(%d)bad type '%c'devnodiratimetry '%s' type '%s' on '%s' bad hw-addr '%s'socket:[energy_nowBattery %d: %d%% Thermal %d: %d.%d degrees C /proc/partitionsNO NAMEUUID|SCHED_RESET_ON_FORKbad width: %s, sizelimit %llustat '%s'set/unset same flagInline_Datadeny%s- %s%salarm: off%s failed/etc/sysctl.conf/proc/net/netlinkNFLOGSIZE/OFF--More-- Size of section headers: %d (bytes) x(ANDROID_RELR)Data size, NDK %.64s (%.64s) Section to Segment mapping: Segment Sections...no more than 8 gateways %s ( %d bytes from %s : icmp type %d code %d set nolistPNG  Mach-O %d-bit 64LLVM IR bitcode-----BEGIN CERTIFICATE-----Unknown signal '%s'max nicefile size (blocks)unlimitedNeed%s %d argument%s0%3o%nnios2*sendtoPROF[2~chmod>1l#|o#free>0getfattridmorev#=1l#w#<0=6Eb:n:s:od<1>3?f:s:w[!fw]timeoutuuencodewatch--longnot gzipgz'%s' not directory %s dhmsBmac_XOPEN_REALTIME_THREADS_XOPEN_STREAMSFILESIZEBITS%s%u%0*llxHunk %d FAILED %ld/%ld. %d: Child returned %dftruncatecan't create '%s'TCNTCMD/dev/%sEXE filename (/proc/PID/exe)CMDLINE minus initial pathReal (before sgid) group nameVIRT %lld%n%llx'%s' not in %sPoint-to-Point ProtocolHostUnknown %10cw/o servers%d/fd%*p: %lX %*X %lX %lX %lX %lu%m[^ ]RFKILL_TYPE=/sys/class/thermalSCHED_DEADLINE-l doesn't take argumentsfirst > last%s %s %s Secure_DeletionCompression_Requested%s: setting flags to =%s failed%.999s%usetns%d min, NODEx(TEXTREL)NT_GNU_GOLD_VERSION %.*s-ocrnlmissing arg-tostoprprntff1flusho IUsedIUse%, yuv4mpeg video(%s) BMP image, %d x %d, %d bpp RSS (KiB)|^ ;,arcppc64xtensasocket %x %x/dev/urandom0x%xVTALRMURG[1~OF%Y-%m-%d %H:%M%m%d%H%M%C%ybasenameddenvflock<1dheadhostnameinotifydsetenforce<1>2i:f#<1>255=1z#<0>86400=0g*w#<0>86400=5t#<0>255=0s:q#<1>255=3p#<1>65535=33434m#<1>255=30rvndlIUF64>1o:%n %i %l %t %s %S %b %f %a %c %d'%s'invalid -c: %ld File %s is a %s while file %s is a %s --%s[:alpha:][[:space:]][[:space:]]*UTCSIGQUEUE_MAXPOSIX2_BC_STRING_MAXconfstr(3)SELinux%c  @@ -bad %%%c %sno :%s/dev/VSIZEInstruction pointerTTYData written to disk%lld/statuspid %datimenorelatimeloud'%s' not user mountable in fstab %s/%d@%cDYNAMICacceptGHRDMDACMetric Ref UseUNKNOWNtcpcan't sync '%s'No_AtimeBus %03d Device %03d: ID %04x:%04x line %d: file '%s' does not existauthorparmbad login %s:%sgetxattr failedXFRMno module found. Type: %s Size of this header: %d (bytes) SYMBOLICCOMMONCORE-parmrk-ixon-rawcrterase-crtkill-hupclunknown option: %s1024-blocksar archiveJPEG image dataLE(bad endian %d) cdefilmnpqRrstuv:*#@.-%%s-%cnycellsockfs[4~setenv%Y-%m-%dfsfreeze<2>2fycst:f:<1vnF(remove-destination)fit:T[-ni]pwdxsetsid&(restrict)(full-time)(no-recursion)(numeric-owner)(no-same-permissions)(overwrite)(exclude)*(mode):(mtime):(group):(owner):(to-command):o(no-same-owner)p(same-permissions)k(keep-old)c(create)|h(dereference)x(extract)|t(list)|v(verbose)I(use-compress-program):J(xz)j(bzip2)z(gzip)S(sparse)O(to-stdout)P(absolute-names)m(touch)X(exclude-from)*T(files-from)*C(directory):f(file):a[!txc][!jzJa]<2>4>1s: File: "%n" ID: %i Namelen: %l Type: %T Block Size: %s Fundamental block size: %S Blocks: Total: %b Free: %f Available: %a Inodes: Total: %c Free: %d?%llx: %s%#.02xbs=stdincmp: EOF on %s allbad headername_POSIX_SPIN_LOCKSRAW_SOCKETSLINK_MAXMAX_CANON_POSIX_SSIZE_MAXSHRT_MAXpathconf(3) gid=\abfrtvbzcatTAR_UID=%o%s: seek %lldCMD:15=THREAD,NAME=PROCESSSCHCMDLINEGROUPSTIME Memrestorecon failed: %srwP-t-PNOTRAILERSNOARPPROMISCcarrierbad address '%s' : %s/proc/net/rawxfs%02x:i2c_read_byteSMBus Block Process Call%s: setting version to %d failed "%s"firmware/proc/self/gid_mapfailed to remove swapareaCouldn't swapon '%s'/proc/%d/%s/proc/%d/mapsprobing alias %s by realname %s symbol:# includecan't unload module %s Entry point address: 0x%x %*.*s EXEC (Executable file)RELINIT_ARRAYPHDRN(NEEDED)x(PLTGOT)x(FINI)x(JMPREL)b(FINI_ARRAYSZ)d(VERNEEDNUM)%6d: %0*x %5lu %-7s %-6s %-9s%3s %s LOCAL-xcaseundefcreadechoeechoctlechokeswtchlnextextproc%2d[%dLqZip archive dataELF one of %s: oguamips-oldpipebad date %sUTC0caticonvnbd_clienttar<2^(foreground)(preserve-status)vk:s(signal):traceroute6ulimitunshareTMPDIR%08llx: %s: Can't skip can't fstat %s+%ldneed directory for -pskipping >2G file '%s'CFfcbor_POSIX_ASYNCHRONOUS_IO_POSIX_THREAD_ATTR_STACKADDR_POSIX_THREAD_PRIORITY_SCHEDULING_XOPEN_UUCPBC_DIM_MAXPTHREAD_THREADS_MAX groups=This is not GNU sed version 9.0 -d.tar.bz2]too many argumentsUSER,%%sPPID,VSIZE,RSS,WCHAN:10,ADDR:10,S,%s%.2s<%d>looprprivate-Ubad argument '%s'%32s %*08x %02x %02x %*02x %15s ESTABLISHEDunix %-6ld %-11s %-10s %-13s %-8lu %u: %s: %s %16.16s I2C Write Blockbad mask '%c'failed to load %sCasefoldline %d: can't chown/chmod '%s'poweroff %*d: %x:%x %x:%x %x %*x:%*x %*X:%*X %*X %*d %*d %ldIPv6SELINUXInvalid option %s found in file %s %s: not a regular fileType 0x%0*llx %-20s RELANOTEb(ANDROID_RELASZ)There are no program headers in this file. There are no sections in this file. Version: 1 (current)speedline-parity-inlcrTIOCSWINSZ %s-echoctl-tandemhupechoprteofeolcs5 !%*s%*s '%s' to '%s:%s'%s special (%u/%u)Android dex file, version %s , cmml textBEOpenType font-t needs oxdnot a tty<>=0'#-+ blackfinmipsnonfssysfsBad '%s'lsldapvRmountpointnohuprfkill(help)(version)e*f*i:;nErz(null-data)s[+Er]seqstat<1^pa<1>2mbin/%s: fsync+++[%dmNeeds 2 argumentsbad --preserve=%sdir at '%s'%%%dX%%n;bad %.*s_POSIX_PRIORITY_SCHEDULING_POSIX_TRACE_EVENT_NAME_MAX_POSIX_V7_ILP32_OFFBIGPOSIX2_C_BINDCOLL_WEIGHTS_MAX_AVPHYS_PAGES_POSIX_NGROUPS_MAX0dir\ %.*s%s%.*sremoving leading '%.*s' from member names !PIDMinor page faultsThread countReal (before suid) user nameGroup namewchan.%02lldNo uuid %s/proc/filesystemsdowninetUNSPEC%-9s Link encap:%s AUTOMEDIAoverrunsgetsockname: bad family/proc/net/tcp6 time=%u mswwanvfat0x%02x Write register 0x%02x from chip 0x%02x on bus %d?acew0rmyndDM uoxread priority/dev/block/proc/modulesBUSNUM=%u DEVNUM=%u %s/lib/modules/%slicense% 8lld% 8lld% 8lld'%s' not key=valuertdUNUSEDSCSITRANSPORT%-9s %5s %10.10s %4s %7s %18s %9s %10s %s .dynstrMemSizNONE (None)Bad name for sh %d VERDEFARM_EXIDXARM_ATTRIBUTESINTERP%s: bad note @%luNT_GNU_BUILD_ID %c%02x-parenb-iutf8vt0ctlechoeol2clocalonocrcr1bs1noflshSO_SNDBUF failed SO_DONTROUTE failed 2J%llu%%, png video, theora video, vorbis audioµ-lawEFI, for Android %dstack (KiB)No '%c' with '%c'not integer: %s\abefnrtvntfsmsdos<2?vfR[-vf]^mp#<0iRbrfo[!ibrfo]gzipioreniceiotopmodprobepidofping<1c:(format)fLt<1^pvtouchtruncate<1s:|cusr/%s:need -f to read TTY%s: %s ==>chmod '%s' to %s '%s' is '%s'%s '%s' bad -I: %ssizetBmac_POSIX_TYPED_MEMORY_OBJECTS_XOPEN_UNIXARG_MAXBC_STRING_MAXASYNC_IOLFS_CFLAGS-Z '%s' failedbad -b '%s'acduoxfdir %s: can't createwPPIDF bad hw '%s'TIME_WAIT[ %s]unblockcur_stateadfssched_setscheduler

gmtime_r failed/sys/class/i2c-devunknownrtdescriptionAddress%*cKbytes PSS Dirty Swap Mode Mapping failed to unload %sSwapFree: Exit status %d /proc/%d/fd Version: 0x%x String dump of section '%s': Bad offset/size %llu/%llu for sh %d d(BIND_NOW)x(VERSYM)Value%x:%x:%x:%x:%ntcgetattr %s^-cmspartraceroute to %s(%s) indexed colorbyte-swapped x86-WAV audio, %s, A-law(DLL) ASCII text, staticcpu time (s)\ %2d) SIG%-9srtmaxromfsfatWINCHOHrename %s -> %sioctl %x@%lld%nmktimechrootcleardos2unix(line-buffered)(color):;(exclude-dir)*S(exclude)*M(include)*ZzEFHIab(byte-offset)h(no-filename)ino(only-matching)rRsvwcl(files-with-matches)q(quiet)(silent)e*f*C#B#A#m#x[!wx][!EFw]<3>3fylog(color):;(full-time)(show-control-chars)ZgoACFHLRSabcdfhikl@mnpqrstuw#=80<0x1[-Cxm1][-Cxml][-Cxmo][-Cxmg][-cu][-ftS][-HL][!qb]>2a#<1=2>9b#<1l#<1[!bl]>0O*Hk*o*p*u*s#<1d%<100=3000m#n#<1bq[!oO]trueumountviwhichUnknown command %sunknown status '%s'Files %s and %s are identical %lld bad read from file '%s'iwholenameperm_POSIX_ADVISORY_INFO_POSIX_SYNCHRONIZED_IOPOSIX2_CHAR_TERM_POSIX_AIO_LISTIO_MAX%s%lduid=%*clu bad -t %s%07lld%07llo%s%s '%s' %7lu PSR32 or 64GIDRGROUPELAPSEDTotal %CPU used since start) %c%n/proc/tty/driverscpu %lld %lld %lld %lld %lld %lld %lld %lldSELinux is disabledenforcingpermissiveasync/%d Driver %sUPonly serversSYN_SENTCLOSINGDGRAMsocket SOCK_DGRAM %xSCHED_FIFO ioctl(I2C_SLAVE)SMBus Write WordSMBus Write Block/dev/i2c-%dIndexed_directoryline %d: bad type %c%u:%u 0 %u 1No %luPrivate_Dirty: %lld%2d:%02d, procs_running %lu%nprocs ------------memory------------ ----swap--- -----io---- ---system-- ----cpu---- File: %s Magic: GLOBALHASHFINI_ARRAYBad phdr %d LOADx(REL)d(RELACOUNT)NT_ARM_TLSThere is no dynamic section in this file.Key: (W)rite, (A)lloc, e(X)ecute, (M)erge, (S)trings, (I)nfo (L)ink order, (O)S, (G)roup, (T)LS, (C)ompressed, x=unknowncookedisigparenbhupcltabsdiscardcs6 !NIFreebroken cpio archive%s, native/usr/bin/envaddress space (KiB)/proc/sys/fs/pipe-max-sizeusage: sparc8+tmpfsCHLDxstrndupchgrp^<1ahu>1bdsfF:[!bdsf]<1rt:Tvnfs<1>1L:pWrxwutnealnl>1P#<1SHavutsrRqpnmlifedc[-SH][!apvutsrRqnmlifedc]rmsleepsplittracerouteuniqunix2dosbad -f no %%f 0x%02x,obs=oflag=count_bytes[:cntrl:]minlinksnewer_POSIX_SEMAPHORES_POSIX_THREAD_ATTR_STACKSIZE_POSIX_THREAD_SAFE_FUNCTIONS_POSIX_THREAD_SPORADIC_SERVERPOSIX2_PBS_MESSAGE_XOPEN_REALTIMEDELAYTIMER_MAXPAGE_SIZE_POSIX_SYMLOOP_MAX_POSIX_THREAD_THREADS_MAXPOSIX2_LINE_MAXPOSIX2_RE_DUP_MAXLFS_LIBS%s does not take a pathbad %%%c@%ld-rc%u path=%nneed )-acommand too long4k pages to swap outRES/proc/%u/task%*ld%llo %s:%10s total,%10s used,%10s free,%10s %sDisabledPermissivesharedunbindableerrors%63s%x%x%X%d%d%d%x%d%d%dinet_ntopuwb %s

%s

settimeofday failedIdleJournaled_DataSWAPSPACE2aliasneed -t or =filenamertc %lld >= %ld%s: unknown '%s'Buffers: %04ounixRDMANOFDbad syntaxmodules.symbols%s: not ELFNameProgram Headers: %-14s %-8s %-*s %-*s %-7s %-7s Flg Align %lld (bytes) R(RPATH)ABSGNU_IFUNC %-20s %10s Description columns-ofill-tabs !H !UIe?1049l%2d InodesGIF89a%d Hz, IEEE floatGSMunknown pid '%s'xsetenv %s to %s=+-no /procsigjfssmackfsABRTALRMxfdopenxreadd:D:I(iso)(iso-8601):;r:u(utc)[!dr]HPkhit*a[-HPh]duload_policymakedevsmd5sumbc(check)s(status)[!bc]>2(no-backup-if-mismatch)(dry-run)F#g#fulp#d:i:Rs(quiet)iamcwlUTF-8sbin/FAILEDdirectory%08x%08x, skip_bytes=%s setxattr(%s=%s)nouserprune_POSIX_THREAD_ROBUST_PRIO_INHERIT_POSIX_TRACE_NAME_MAX_POSIX_TRACE_USER_EVENT_MAXMQ_PRIO_MAXPOSIX2_CHARCLASS_NAME_MAX %s '%s' %s a directory%s: empty archive.tbzTAR_FILENAMEbad -u%d NICEPRINiceness (static 19 to -20)Scheduling policy (0=other, 1=fifo, 2=rr, 3=batch, 4=iso, 5=idle)TIDElapsed time since PID startREADStart time (ISO 8601)Process state: R (running) S (sleeping) D (device I/O) T (stopped) t (trace stop) X (dead) Z (zombie) P (parked) I (idle) Also between Linux 2.6.33 and 3.13: x (dead) K (wakekill) W (waking) host %s: %*s,EVIOCGVERSION failed for %squietnodev-fsr-fsarpinet6:%02xBase address:0x%x %d/%s::/sys/class%02X%s min/max priority : %d/%d pid %ld's current scheduling policy: %s%s %0*lld %s 

SMBus Receive Bytereading flags '%s'Swapspace size: %luk%s, UUID=%s
/sys/block/%.32s/pidunknown key '%s' %02d:%02d:%02d up set_name_typectxt %d,%d%*x-%*x %*s %llx %s %ld %nORIGINSYMTAB_SHNDXx(INIT)x(PREINIT_ARRAYSZ)0x%x	NT_ARM_VFPstandard inputixonrows %d; columns %d;inlcrtab2M1mUsed, %d x %d, %d-bit/%s, %sinterlacedSVR4 with CRC, celt audioHOMERT time (us): %scwbkmgtpemetagsparc27m%s%s%s: %sinotifyRTMAXdevptsprocSEGVTRAP0mOSxreallocbase64^<1as:htgmkb[!htgmkb]grep<4fymkdirnetcatswapon^>2<1Ccsd[+cC]whoami>1c#l#o#g#<1=2iprs#[!rs]OKaAeEfFgGconv=+oemptyexecdir_POSIX_SHELL_NPROCESSORS_ONLNMAX_INPUT_POSIX_CHILD_MAXUINT_MAXCHAR_BITLFS_LDFLAGS%s%u(%s)o2tiltw '%s'unknown file type '%o'PID,PR,USER,%sREAD,%sWRITE,SWAP,%sIO,COMM-%sIO,-ETIME,-PIDNo PATTERNProcess IDVSZDREADPCY-::Could not set context to %s: Killed %s(%d) with signal %d
Need 1 arg or -adelRDM: %ld(%ld) bytes.
sched_getparamlocaltime_r failed/dev/stdinneeds %d arg%sno '=' with '-' or '+'need '-p', '-v', '=', '-', or '+'%-23s Size  Used by
line %d: can't create node '%s'%s:%*c%s is %sa mountpoint
'%s' -> '%s'Device: %s
showwakeup using "%s" from %s at %s/proc/vmstatCONNECTORDEVICEinsmod %s
%02x%cOffPROGBITSSYMTAB  %-20.*s 0x%08x	brkintcs7-noflsh-cbreakintriutf8probe addr failednmMounted onnon-xz compressed dataPCM, built by NDK %.64s (%.64s)message queuesMax %d argument%s%lld > %lld%*c%sr%F %TscoreSTKFLT%Y-%m-%dT%T%2u%n<1>1f(force)l(length)#<0o(offset)#<0s(secure)z(zeroout)[!sz]expandi2cset?ls: lsattrlsofpastesha1sum<1>1t|d|u:T[!td]xxden_US.UTF-8%s%s: %sgethostbyname: %sbad -l[:digit:]-d needs -Ff%FT%T,%N%:zaok_POSIX_BARRIERSPOSIX2_PBS_TRACKAIO_MAXSEM_NSEMS_MAXINT_MIN%s disabled%06llxno }aci-i on stdinno previous regex
==> %s <==
Short RSS%lld %*d %lld%s->%lldpid %d's %s affinity mask: setlog cut at 1024 bytesoutfill%10cMULTICASTTX bytesDMA chan:%x bad argument count  MSS Window  irtt %d: %x:%x %x:%x %x %x:%x %*X:%*X %*X %d %*d %ldunknown cmd '%s'1248gettimeofday failedDump chip 0x%02x on bus %d?Read register 0x%02x from chip 0x%02x on bus %d?SMBus Write Byte-fno fileWake time:	%lld / %sgmtime_r... %s: %lx
pgpgout pswpout FIREWALLENCRYPTFSAll modules loadedblacklist%s: empty  Class:                             ELF%d
.strtabBIND_NOWRELRS(SONAME)b(ANDROID_RELRSZ)x(VERNEED)Linuxoposticanonff0 (%d) !F-%dpcolor RGBTruespeechMS PE32%s executable %s, corrupt?%.*s
%s/%s/proc/%u/comm<%02X>extext3smbXCPUIOunknown speed: %dno temp filedevmemdmesg?n(lines)#<0=10c(bytes)#<0qv[-nc]lnpgrep<1areadlink<1wftesttimeset '%s'%s: write errorabfnrtv"\Common subdirectories: %s and %s
 --%FT%T%:z%09udepthprint_POSIX_IPV6_POSIX_JOB_CONTROL_POSIX_TIMERS_POSIX_TRACE_SYS_MAXPOSIX2_UPETTY_NAME_MAXCHOWN_RESTRICTEDV7_ENVULONG_MAXPOSIX2_BC_BASE_MAXCS_PATH -> FDL+++ igpx}; 	
bad pattern '%s'@%ld (%c)-f on '%s' failedbzip2.tbz2.tgz%u,%uTAR_MTIME=%llosettime %lld %sThread IDEXE path (/proc/PID/exe)VSZ as % of physical memory
Gid:
VmSwap:[%s]/proc/stat
Cached:ronoatimeUUID=swapmtuaddbad %s at %s %s:%s TimeoutudpSEQPACKETultrawideband???I2C AdapterSMBus PECbe%s/loop%d
%s:
reading '%s'Undeletecan't create directory '%s'ioctl failedlocaltime_r%s="%s"
GENERIC/etc/modprobe.conf
needs a flag  ABI Version:                       %d
%s: bad phoffREL (Relocatable file)ANDROID_RELAGNU_HASHGNU_EH_FRAMEb(SYMENT)x(DEBUG)-brkintek-echokepollCapacity%s: %*sPNG image dataGIF image data, version %3.3s, %d x %d
old, dirac video%d-bit, EFI ROMcore dump32-bit -%c: %-25s Missing argument to xunsetenv %s name has =lseek\abeEfnrtv'"?0%lluRTMINHUP%d;%dH[19~xpipeshort readping6<1^f(fork);r(map-root-user);i:(ipc);m:(mount);n:(net);p:(pid);u:(uts);U:(user);uptimeuudecode-s only with -cbad line %sFailed to create %s %siflag=[:space:]%s not under %suser_POSIX_MEMLOCK_POSIX_MESSAGE_PASSING_POSIX_READER_WRITER_LOCKS_POSIX_THREAD_PROCESS_SHAREDNAME_MAX_POSIX_SIGQUEUE_MAXCHAR_MINSCHAR_MAXPOSIX2_EXPR_NEST_MAX%s%ld%s%c context=:%02d.%09d cbad path %sxzcat'%s' bad symlinkMissing ']'need arg @%d %*ldProcess Group IDread_bytes:RTtZ%s%-*.*s%s
1fstabmulticasttxqueuelen/sys/class/net/%s/addressHWaddr %10c%sservers and established/proc/net/raw60.0.0.0SYN_RECV%-6s%6d%7d %*.*s %*.*s %-11sSTREAM %s="%s"too much databad projid %luPRODUCT=%x/%x/depends%s=Every %u.%0*us:/proc/%d/statrootTCP %s:%d->%s:%d (%s)FDprobing by module nameloaded %s '%s': %s
::::::::::::::
%s
::::::::::::::
%s: bad shoffUNIX - System Vb(PLTRELSZ)x(ANDROID_REL)b(ANDROID_RELSZ)INTERNALbad -g stringoddp-inpck-istrip-iuclc-imaxbel%x%c-flusho !Pset listAvail7z'OS/264-bit data size (KiB)/proc/%u/cmdline%zc6xmicroblaze-oldsparc9POLLLINES[17~unlink '%s'xreadall%H:%Mb*|c*|f*|F*|C*|O(output-delimiter):d:sDn[!cbf]<2>2(color)(strip-trailing-cr)B(ignore-blank-lines)d(minimal)b(ignore-space-change)ut(expand-tabs)w(ignore-all-space)i(ignore-case)T(initial-tab)s(report-identical-files)q(brief)a(text)L(label)*S(starting-file):N(new-file)r(recursive)U(unified)#<0=3freeramdiskncdfk123456789[-123456789]<1p:t:d:sprintfpstail>0pszcat--versionutimensat%s: no linesXXX
eEtimeout pid %d signal %d
seek_bytes%llu+%llu records in
%llu+%llu records out
%s %s	%s
non-integer argumentdivision by zero!=Skipped dir '%s'-pselect limitbad -type '%c'groupacCLK_TCKPTHREAD_KEYS_MAX_POSIX_LINK_MAX_POSIX_RTSIG_MAXUSHRT_MAXPOSIX2_BC_SCALE_MAXcannot create %s link from '%s' to '%s' %-*s ndoxd2\%c--- '%s' not in archiveTAR_FILETYPEbad -tPrio Reversed (dyn 39-0, RT)Processor last executed onSecurity labelShared memorySwap I/OFlags 1=FORKNOEXEC 4=SUPERPRIV%lld/fd/%i%lldkCouldn't set enforcing status to '%s'privateallmultibroadcast/sys/class/net/%.15s/device/driver/proc/%d/cmdline'%s' needs IDENTIFIERoffreiserfsI2Cmax 1 arg%s %s
Synchronous_Directory_UpdatesAppend_Only%s: setting projid to %u faileddeviceintreefilenamesuspendintr 0t%lld%*p %u %*u %*x %*u %*u %*u %*u %*u %lu 
rqFlags: %s: [%s]
STRTABTLSGNU_RELROx(NULL)x(TLSDESC_GOT)UNDOBJECTPROTECTEDNT_386_TLS  No strings found in this section.-isignl0tab3 !Sb~q!%08xobject, kate text, mng video, speex audioCEUTF-8 textdatano begin linebegin%s 744 %s
 (see "%s --help")chmod '%s' to %04otile7m/dev/nullxgetcwdZ+-+-<1>1(setro)(setrw)(getro)(getss)(getbsz)(setbsz)#<0(getsz)(getsize)(getsize64)(getra)(setra)#<0(flushbufs)(rereadpt)chown<1>1nsux[-sux]getconf<1Z:vp(parent)(parents)m:alrqvsDbd*(all)<1?^vmstatw%dlocalhost
%n %s %b %f %u %g %D %i %h %t %T %X %Y %Z %o+++ %s
,%ld <='\''timestampsbad format '%s'nogroupbad -printf %%%c_POSIX_THREAD_PRIO_PROTECT_POSIX_TRACE_INHERITATEXIT_MAXSYMLINK_MAX_POSIX_SYMLINK_MAXx2%*llubtTqQ:%s: can't mkdirpts/%CPUDIO %*s-S%xbad mask '%s'[%5lld.%06lld] noexecrsharedignorekeepalive%2x%nDEBUG[NO FLAGS] collisionsProto RefCnt Flags       Type       State         I-Node%sPath
CLOSE_WAITLAST_ACKRAWcapacityneed 1 of -p or COMMANDSMBus Process CallTop_of_Directory_Hierarchies/sys/bus/usb/devices//proc/self/uid_mapRTC time: %s
DEV_PLUS_VIDcpu Bad %sin %s: %s%s (readlink: %s)%s [%s]:%d->[%s]:%dROUTECRYPTO  Data:                              2's complement, %s endian
Address      [Requesting program interpreter: %*s]
NOBITSDYNSYMVERNEEDx(STRTAB)x(INIT_ARRAY)NOTYPENT_GNU_ABI_TAG	OS: %s, ABI: %u.%u.%ucolsparity-onocrsuspinpckonlretbad address:  %s  !COxj%-*s7-zip archive datax86lskip to %lldarm64criscsky386inotify_initRTMIN+%dINTK'%s' > %ld bytesvfork%H:%M:%S%m%d%H%M%ycal<2>2321cpdirname>0(fast)f(rtc):u(utc)l(localtime)t(systz)s(hctosys)r(show)w(systohc)[-ul][!rtsw]^tc#<0>3=2n#<0>7=5p#lsusbmodinfo<1nqmef(canonicalize)[-mef]syncsysctl<1acd:fmr:t:h[!dtr]cndDflrat*v[!na]PATHunexpected ftruncate failure%llu bytes (%s) copied, Files %s and %s differ
(Expected )_POSIX_REGEXP_POSIX_SPAWN_POSIX_LOGIN_NAME_MAX_POSIX_PATH_MAXSHRT_MIN,%uis \total %s
o1bfnrtav0%0*llocreating %s
diouxXrm %s%s%sno patternsparse overflow'%s' %s not under '%s'F,S,UID,%sPPID,C,PRI,NI,BIT,SZ,WCHAN,TTY,TIME,CMD  %-8s%s
Virtual memory size (1k units)Process name (PID's argv[0])USERData writtenattr/currentcmdlinesys/proc/meminfo %d: %8x%8x%8x%8x:%x %8x%8x%8x%8x:%x %x %x:%x %*X:%*X %*X %d %*d %ld:%sCooling %d: %s %d of %d
%5u Immutable%-19s %8s  %s %s
not cwdtxtFIB_LOOKUPmem%s (opendir: %s)ANDROID_RELRF(FLAGS_1) (VERDEF)LINUXNT_FILE%s: no section '%srowssaneixoffofdelechonlSO_DEBUG failed Jh[%dMmonoXBOXread '%s'real %f
user %f
sys %f
begin%*[ ]%15s%*[ ]%ntssavr32bpfriscvsetsockoptQUITPWRSTOP[6~OR[18~[20~gid %lddffind(only-values)dhn:help<3>3ns<1F(no-fork)t#<1(target)i:(ipc);m:(mount);n:(net);p:(pid);u:(uts);U:(user);pivot_rootrenicetasksettrusleepuuidgen>0r(random)/tmp%.*ss%f s, %s/s
| -%c[:lower:][:upper:]%s: overwrite '%s'%FT%H%:zTZ="mindepth%lld.%ldPOSIX2_C_DEVPOSIX2_PBS_LOCATEPATH_MAXrmdir %sNAME/proc/sys/kernel/pid_maxParent Process IDPGIDRealtime priority%MEM%0*ldidleiowcurrent%u,%*u,%llu,%*[^;]; %nrunbindablenetmaskdefault%10cinet6 addr: %s/%d Scope: %s
Interrupt:%d    DCCPLISTENINGround-trip min/avg/max = %lu/%lu/%lu ms
energy_full/dev/%.20schcon '%s' to %s
/dev/rtc0%F %T%z-F BUSNo_Tailmergingbad '%c'read flags of '%s'pcbdf/vendorsrcversionparmtypeNo %ld
off no on disable show %sRTC time:	%lld / %salarm: on %skey '%s'VLAN_PLUS_VIDCached: listxattr failedNETFILTER/lib/modules/%s%s already loaded
removemodule %s not found in modules.dep  Machine:                           %s
  [%2d] %-20s %-14s %0*llx %06llx %06llx %02llx %3s %2d %2d %2lld
ANDROID_RELphdr %d has bad offset/size %llu/%llux(SYMBOLIC)x(RELR)DEFAULTNT_PRSTATUSNT_SIGINFOBad dynamic entry size 0!-oddp-echoecstopb %s ( sendtoGd512-blocksbad tablistgrayscale with alphaASCII cpio archive (%s)
Android DTB/DTBO v%d, %d entries
oxdopen files-%c < %lfbad utf8 %xm68knot foundbindBUSSYS/dev/ttybad uid %ldabctVcpiofgrepgetopt<2<1b:k:F:0nsenter<1(ignore-fail-on-non-empty)p(parents)sha224sumsha256sum<1>1p#<0>32767d0.8.4-androidgzdopen-p + /template%.*f+-<>/%, bad arg %scan't compare stdin to directory&motcreate %s'%s' needs 1 arg_POSIX_REALTIME_SIGNALS_POSIX_SAVED_IDS_POSIX_V7_ILP32_OFF32BC_BASE_MAXTZNAME_MAX_NPROCESSORS_CONFNO_TRUNCs ldNeeds 1 argumentNot tarshort header %s/%s TAR_UNAMETAR_GID=%ocan't open '%s'%s: exited with status 255; abortingMAJFLUser name
VmLck:sirq%ss: %d total, %3ld running, %3ld sleeping, %3ld stopped, %3ld zombieEnforcingneed major/minorMax 2 arguments
slaverslavemem_startCompat MTU:%ddroppedTX packets%-15.15s %-15.15s %-16s%-6s%-6d %-2d %7d %s
FIN_WAIT1CLOSEno v%d addr for -I %s%d bytes from %s: icmp_seq=%d ttl=%dPid %ld, class %s (%ld), prio %d
%-10lu table = 
vermagic%s: not a %s
Pss: %lld/proc/%d/cwdset_egress_mapTCP [%s]:%d->[%s]:%d (%s)go_prob'ing %s
--More--(%d%% of %lld bytes)big  Size of program headers:           %d (bytes)
TagNOWP(PLTREL)%x%n-igncr-ixoff-crterase !AlAvailable!
07070pre-SVR4 or odcTrueType font, corrupt phentsize %d?-base64<>= only after .#%%/procXFSZ..Not a number '%s'blkid<1(preserve):;D(parents)RHLPprdaslvnF(remove-destination)fit:T[-HLPd][-ni]<1w(follow)CSTtrs#<1n#c[!Ttr][!Cc][!Sw]d#<0=-1hmlcaHkKLsxb[-HL][-kKmh]<1>1^?aSinsmod<1>1s#=115200Xmv<1^?cld:u*U*t*s*P*g*G*fnovxL:[-no]readelf<1gpun#|unameof=conv=%x
bad %s=%snoerrorOnly in %s: %s
Unexpected extra input '%s'
stripinamewholenameexec_POSIX_MAPPED_FILESAIO_LISTIO_MAXINT_MAX%%*%s%%%s%sremoving %s
feEgGro eqnegtgeltleargument too longbad -L '%s'PRWhich processor running onWRITEbuffersCommand line field types:
%s failed %dmetricio_addrRX bytes%s:%llu socket path too long %sblockwifiTYPE
%s

syntax error%s Class %s: %s:%stable = %s
%.*s  ------  ------  ------  ------
local%d day%s, DEV_PLUS_VID_NO_PAD%luMemFree: netlinkinsmod %s %s
(Enter:Next line Space:Next page Q:Quit R:Show the rest)  OS/ABI:                            %s
WAXxMSILOTCVirtAddrPhysAddr%02x%sb(INIT_ARRAYSZ)b(RELRSZ)SECTIONWEAKELF Header:-paroddcs8can't bind to interface %sL%2d %ssymbolic link to %scannot open: %s
ELF (GNU)BZhshared libraryOgg data%d-channel, MP3extensibleAndroid boot image v%d
 (fdpic)RT prioritycan't set -apcouldn't unlink '%s'xwrfrvmn10300-oldsh486^%cconnectrtminext2TTOU?25h%s%s<2hvRHIPLN?<1>3^tElLw#<1W#<1p#<1>65535q#<1s:f:46uU[!tlL][!Lw][!46U]^<1n#<2>2restorecon(list-modes);(auto)a(device)d:(local)l(mode)m:(seconds)s#(time)t#(utc)u(verbose)v[!alu]sha512sumgS:T:mo:k*t:xVbMcszdfirun?aF:g[!ag]tee.gz%%0%d.%df%s: read error)M-ownershipxattr%FT%R%:zpathtypemaxdepth_POSIX_RAW_SOCKETS_POSIX_TIMEOUTS_POSIX_V7_LPBIG_OFFBIG_XOPEN_SHMHOST_NAME_MAXPIPE_BUFSYNC_IO_POSIX_SEM_VALUE_MAX_POSIX_TTY_NAME_MAXSSIZE_MAX/bin:/usr/bin(standard input)--bad -n '%s'can't remove: %scan't link '%s' -> '%s'  %-8s%*s%cResident Set Size (DRAM pages)COMMCOMMANDRUSERProcess state (S) plus:
	  < high priority          N low priority L locked memory
	  s session leader         + foreground   l multithreadedno -o%d%%cpu'%s'->'%s'dstaddrBcastKernel IP routing table
Destination	Gateway 	Genmask 	Flags %s Iface
ACC Ping %s (%s)bluetooth/dev/rfkill%s:need --option-iSMBus Read Block%s: prio %d
No_Dump%0*llx % *lld%s USERSOCK  Flags:                             0x%x
0x%llx

Displaying notes found in: %s
x(SYMTAB)d(RELCOUNT)-ixany%x:%x:%x:%x:line = %d;
tab0-cookedcrtkillofillLSRR IP_OPTIONSIP_TOS %ld failed ERROR :Range for -f is 1 to %ld (max ttl) !Hsetsockopt ttl %d$, opus audioboot====-+!%s--%.*sToybox %s multicall binary: https://landley.net/toybox (see toybox --help)

.%09ld h8300unknown arch %dforkFPEOQ()xsignal %dULs*[!LU]uvtecmpcut^?Een[-eE]>3aFlyi2cgetemknnetstatprintenv%s  %s
bad -f '%s'@%dbad -s: '%s'skip=oflag%s: invalid option '%c'
bad equiv class[:blank:][:xdigit:]%ld %o %o
-s needs -Ffipathinum-exec without %s_POSIX_SPORADIC_SERVER_POSIX_TRACE_LOGPAGESIZEPTHREAD_DESTRUCTOR_ITERATIONS_POSIX_HOST_NAME_MAXno REGEX==> %s <==
*.*%c*.*ll%cbad \x-chLbcdefgkpSusxwrbad -kBITWait location in kernelfd/RT.%d% *lld%%%s[%.*s] no name--move with -t%s cleared
hwEthernetunspecLinkRUNNING  Metric:%d PID/Program Name/sys/class/power_supplyCooling %d: %s no state information
ext4
%s
Probe chips 0x%02x-0x%02x on bus %d?SMBus Read ByteSMBus Read WordExiting     0  1  2  3  4  5  6  7  8  9  a  b  c  d  e  fclassretpoline%s/../proc/self/setgroups/proc/%u/%smaps-m %s needs -s or -tSwapTotal: /proc/%d/fdinfo/%s%s %s:%d->%s:%dDNRTMSG/etc/modprobe.d  Start of program headers:          %llu (bytes into file)
  Number of section headers:         %d
%s: bad shstrndxPIE0x%llxSHLIBPREINIT_ARRAYb(STRSZ)f(FLAGS)x(ANDROID_RELA)x(ANDROID_RELRENT)Symbol table '%s' contains %d entries:
   Num:    %*s  Size Type    Bind   Vis      Ndx Name
FILEospeed-icanonimaxbel-extprocnl1H2K1K-blocksIHDRgrayscalestereoCELPPEM certificatepipe size (512 bytes)end-%c < %ld-%c > %ld%s
xwrstXbad mode '%s' kMGTPEZY%8o:COLUMNSxclose%a %b %e %H:%M:%S %Z %Y%y%m%d%H%M%2u%2u%nchconcommfile^a(alternative)n:(name)o:(options)l*(long)(longoptions)Tugroupsifconfigionice<1qdx[-dx]?Vu*U*t*s*P*g*G*fnovxl:[-no]<1DFnRrvrunconsendeventstty^neNqwpaA[!ap][!aq][!aw][+aA]ttyxargsneed XXX -> '%s' 'bad '%s'no selectionscannot set datetotal-!('%s': loop detectedexecutable_POSIX_CLOCK_SELECTION_POSIX_CPUTIMEPOSIX2_SW_DEVRE_DUP_MAXSTREAM_MAXSYMLOOP_MAX_POSIX_VDISABLE_POSIX_AIO_MAXLONG_BITPOSIX2_COLL_WEIGHTS_MAXsysconf(3)-+# '0*.*L%c%s: Check line %d
/proc/self/fd/%d  %d-%02d-%02d %02d:%02d%s TAR_MODE=%obad -GUSER:12=UID,%%sPPID,%s,STIME,TTY,TIME,ARGS=CMDLABELbad -OSZControlling terminalWCHANRGIDReal (before sgid) Group ID%VSZSWAP%*.*sexe<%u>[%llu.%llu] %npcub%s unmounted
up/proc/net/if_inet6SiteSLAVE User       Inode      recvmsg0x%0*llx
Need -p or COMMAND, offset %lluProject_Hierarchy/sys/bus/pci/devicesset_ingress_mapUDPVERSYMx(PREINIT_ARRAY)x(GNU_HASH)NT_VERSION	API level %uignpartostop,.:;=-+*/(){}<>[]!@#$%^&|\?"', %sstripped%s%*cNeeds %s-%s\

	'"?%*s/dev/randomOP%m%d%H%M<2h(no-dereference)PLHRfv[-HLP]cksumcdfk123456789[-123456789]mktemppartprobetactunctlwcempty '%s'%	acmokdir_POSIX_MEMORY_PROTECTION_POSIX_THREAD_CPUTIME_POSIX_THREADSAIO_PRIO_DELTA_MAXLINE_MAXMQ_OPEN_MAX_PHYS_PAGES%-34s atn%*lldno s//\%d/%s -%CPU,-ETIME,-PIDHELPETIMERUIDData read from diskThreadremount%s: need -t%s remounted ro
PORTSELRX packetsRFKILL_NAME=temp %u %u %u %[^
 ]		total        used        free      shared     buffers
Mem:%17s%12s%12s%12s%12s
-/+ buffers/cache:%15s%12s
Swap:%16s%12s%12s
Realtimebad version %ldReading RTC.../proc/sys/%sset_flag/proc/%d/proc/%d/fd/%spos: %lld flags: %ocan't load module %s (%s)%s: bad ELFDynamic section at offset 0x%llx contains %lld entries:
  %-*s %-20s %s
NODELETEShared libraryLibrary runpathDYN (Shared object file)iextenstartwqunknown type, requires at least v%d.%d to extract, version %d.%d, jng videoEFI runtimeshared objectMSB missing argumentCan't set prioritycore dump size (blocks)begin-base64%*[ ]%15s%*[ ]%nusage: toybox [--long | --help | --version | [COMMAND] [ARGUMENTS...]]

With no arguments, "toybox" shows available COMMAND names. Add --long
to include suggested install path for each command, see
https://landley.net/toybox/faq.html#install for details.

First argument is name of a COMMAND to run, followed by any ARGUMENTS
to that command. Most toybox commands also understand:

--help		Show command help (only)
--version	Show toybox version (only)

The filename "-" means stdin/stdout, and "--" stops argument parsing.

Numerical arguments accept a single letter suffix for
kilo, mega, giga, tera, peta, and exabytes, plus an additional
"d" to indicate decimal 1000's instead of 1024.

Durations can be decimal fractions and accept minute ("m"), hour ("h"),
or day ("d") suffixes (so 0.1m = 6s).truetestusage: acpi [-abctV]

Show status of power sources and thermal devices.

-a	Show power adapters
-b	Show batteries
-c	Show cooling device state
-t	Show temperatures
-V	Show everythingusage: base64 [-di] [-w COLUMNS] [FILE...]

Encode or decode in base64.

-d	Decode
-i	Ignore non-alphabetic characters
-w	Wrap output at COLUMNS (default 76 or 0 for no wrap)usage: basename [-a] [-s SUFFIX] NAME... | NAME [SUFFIX]

Return non-directory portion of a pathname removing suffix.

-a		All arguments are names
-s SUFFIX	Remove suffix (implies -a)usage: blkdiscard [-olszf] DEVICE

Discard device sectors.

-o, --offset OFF	Byte offset to start discarding at (default 0)
-l, --length LEN	Bytes to discard (default all)
-s, --secure		Perform secure discard
-z, --zeroout		Zero-fill rather than discard
-f, --force		Disable check for mounted filesystem

OFF and LEN must be aligned to the device sector size.
By default entire device is discarded.
WARNING: All discarded data is permanently lost!usage: blkid [-s TAG] [-UL] DEV...

Print type, label and UUID of filesystem on a block device or image.

-U	Show UUID only (or device with that UUID)
-L	Show LABEL only (or device with that LABEL)
-s TAG	Only show matching tags (default all)usage: blockdev --OPTION... BLOCKDEV...

Call ioctl(s) on each listed block device

--setro		Set read only
--setrw		Set read write
--getro		Get read only
--getss		Get sector size
--getbsz	Get block size
--setbsz BYTES	Set block size
--getsz		Get device size in 512-byte sectors
--getsize	Get device size in sectors (deprecated)
--getsize64	Get device size in bytes
--getra		Get readahead in 512-byte sectors
--setra SECTORS	Set readahead
--flushbufs	Flush buffers
--rereadpt	Reread partition tableusage: cal [[MONTH] YEAR]

Print a calendar.

With one argument, prints all months of the specified year.
With two arguments, prints calendar for month and year.

-h	Don't highlight todayusage: cat [-etuv] [FILE...]

Copy (concatenate) files to stdout.  If no files listed, copy from stdin.
Filename "-" is a synonym for stdin.

-e	Mark each newline with $
-t	Show tabs as ^I
-u	Copy one byte at a time (slow)
-v	Display nonprinting characters as escape sequences with M-x for
	high ascii characters (>127), and ^x for other nonprinting charsusage: chattr [-R] [-+=AacDdijsStTu] [-p PROJID] [-v VERSION] [FILE...]

Change file attributes on a Linux file system.

-R	Recurse
-p	Set the file's project number
-v	Set the file's version/generation number

Operators:
  '-' Remove attributes
  '+' Add attributes
  '=' Set attributes

Attributes:
  A  No atime                     a  Append only
  C  No COW                       c  Compression
  D  Synchronous dir updates      d  No dump
  E  Encrypted                    e  Extents
  F  Case-insensitive (casefold)
  I  Indexed directory            i  Immutable
  j  Journal data
  N  Inline data in inode
  P  Project hierarchy
  S  Synchronous file updates     s  Secure delete
  T  Top of dir hierarchy         t  No tail-merging
  u  Allow undelete
  V  Verityusage: chcon [-hRv] CONTEXT FILE...

Change the SELinux security context of listed file[s].

-h	Change symlinks instead of what they point to
-R	Recurse into subdirectories
-v	Verboseusage: chgrp/chown [-RHLP] [-fvh] GROUP FILE...

Change group of one or more files.

-f	Suppress most error messages
-h	Change symlinks instead of what they point to
-R	Recurse into subdirectories (implies -h)
-H	With -R change target of symlink, follow command line symlinks
-L	With -R change target of symlink, follow all symlinks
-P	With -R change symlink, do not follow symlinks (default)
-v	Verboseusage: chmod [-R] MODE FILE...

Change mode of listed file[s] (recursively with -R).

MODE can be (comma-separated) stanzas: [ugoa][+-=][rwxstXugo]

Stanzas are applied in order: For each category (u = user,
g = group, o = other, a = all three, if none specified default is a),
set (+), clear (-), or copy (=), r = read, w = write, x = execute.
s = u+s = suid, g+s = sgid, +t = sticky. (o+s ignored so a+s doesn't set +t)
suid/sgid: execute as the user/group who owns the file.
sticky: can't delete files you don't own out of this directory
X = x for directories or if any category already has x set.

Or MODE can be an octal value up to 7777	ug uuugggooo	top +
bit 1 = o+x, bit 1<<8 = u+w, 1<<11 = g+1	sstrwxrwxrwx	bottom

Examples:
chmod u+w file - allow owner of "file" to write to it.
chmod 744 file - user can read/write/execute, everyone else read onlychgrpusage: chroot NEWROOT [COMMAND [ARG...]]

Run command within a new root directory. If no command, run /bin/sh.usage: chrt [-Rmofrbi] {-p PID [PRIORITY] | [PRIORITY COMMAND...]}

Get/set a process' real-time scheduling policy and priority.

-p	Set/query given pid (instead of running COMMAND)
-R	Set SCHED_RESET_ON_FORK
-m	Show min/max priorities available

Set policy (default -r):

  -o  SCHED_OTHER    -f  SCHED_FIFO    -r  SCHED_RR
  -b  SCHED_BATCH    -i  SCHED_IDLEusage: cksum [-IPLN] [FILE...]

For each file, output crc32 checksum value, length and name of file.
If no files listed, copy from stdin.  Filename "-" is a synonym for stdin.

-H	Hexadecimal checksum (defaults to decimal)
-L	Little endian (defaults to big endian)
-P	Pre-inversion
-I	Skip post-inversion
-N	Do not include length in CRC calculation (or output)Clear the screen.usage: cmp [-l] [-s] FILE1 [FILE2 [SKIP1 [SKIP2]]]

Compare the contents of two files. (Or stdin and file if only one given.)

-l	Show all differing bytes
-s	Silentusage: comm [-123] FILE1 FILE2

Read FILE1 and FILE2, which should be ordered, and produce three text
columns as output: lines only in FILE1; lines only in FILE2; and lines
in both files. Filename "-" is a synonym for stdin.

-1	Suppress the output column of lines unique to FILE1
-2	Suppress the output column of lines unique to FILE2
-3	Suppress the output column of lines duplicated in FILE1 and FILE2usage: cp [-adfHiLlnPpRrsTv] [--preserve=motcxa] [-t TARGET] SOURCE... [DEST]

Copy files from SOURCE to DEST.  If more than one SOURCE, DEST must
be a directory.

-a	Same as -dpr
-D	Create leading dirs under DEST (--parents)
-d	Don't dereference symlinks
-F	Delete any existing destination file first (--remove-destination)
-f	Delete destination files we can't write to
-H	Follow symlinks listed on command line
-i	Interactive, prompt before overwriting existing DEST
-L	Follow all symlinks
-l	Hard link instead of copy
-n	No clobber (don't overwrite DEST)
-P	Do not follow symlinks
-p	Preserve timestamps, ownership, and mode
-R	Recurse into subdirectories (DEST must be a directory)
-r	Synonym for -R
-s	Symlink instead of copy
-t	Copy to TARGET dir (no DEST)
-T	DEST always treated as file, max 2 arguments
-v	Verbose

Arguments to --preserve are the first letter(s) of:

        mode - permissions (ignore umask for rwx, copy suid and sticky bit)
   ownership - user and group
  timestamps - file creation, modification, and access times.
     context - security context
       xattr - extended attributes
         all - all of the aboveusage: cpio -{o|t|i|p DEST} [-v] [--verbose] [-F FILE] [--no-preserve-owner]
       [ignored: -m -H newc]

Copy files into and out of a "newc" format cpio archive.

-F FILE	Use archive FILE instead of stdin/stdout
-p DEST	Copy-pass mode, copy stdin file list to directory DEST
-i	Extract from archive into file system (stdin=archive)
-o	Create archive (stdin=list of files, stdout=archive)
-t	Test files (list only, stdin=archive, stdout=list of files)
-d	Create directories if needed
-u	unlink existing files when extracting
-v	Verbose
--no-preserve-owner (don't set ownership during extract)usage: cut [-Ds] [-bcfF LIST] [-dO DELIM] [FILE...]

Print selected parts of lines from each FILE to standard output.

Each selection LIST is comma separated, either numbers (counting from 1)
or dash separated ranges (inclusive, with X- meaning to end of line and -X
from start). By default selection ranges are sorted and collated, use -D
to prevent that.

-b	Select bytes
-c	Select UTF-8 characters
-C	Select unicode columns
-d	Use DELIM (default is TAB for -f, run of whitespace for -F)
-D	Don't sort/collate selections or match -fF lines without delimiter
-f	Select fields (words) separated by single DELIM character
-F	Select fields separated by DELIM regex
-O	Output delimiter (default one space for -F, input delim for -f)
-s	Skip lines without delimitersusage: date [-u] [-I RES] [-r FILE] [-d DATE] [+DISPLAY_FORMAT] [-D SET_FORMAT] [SET]

Set/get the current date/time. With no SET shows the current date.

-d	Show DATE instead of current time (convert date format)
-D	+FORMAT for SET or -d (instead of MMDDhhmm[[CC]YY][.ss])
-I RES	ISO 8601 with RESolution d=date/h=hours/m=minutes/s=seconds/n=ns
-r	Use modification time of FILE instead of current date
-u	Use UTC instead of current timezone

Supported input formats:

MMDDhhmm[[CC]YY][.ss]     POSIX
@UNIXTIME[.FRACTION]      seconds since midnight 1970-01-01
YYYY-MM-DD [hh:mm[:ss]]   ISO 8601
hh:mm[:ss]                24-hour time today

All input formats can be followed by fractional seconds, and/or a UTC
offset such as -0800.

All input formats can be preceded by TZ="id" to set the input time zone
separately from the output time zone. Otherwise $TZ sets both.

+FORMAT specifies display format string using strftime(3) syntax:

%% literal %             %n newline              %t tab
%S seconds (00-60)       %M minute (00-59)       %m month (01-12)
%H hour (0-23)           %I hour (01-12)         %p AM/PM
%y short year (00-99)    %Y year                 %C century
%a short weekday name    %A weekday name         %u day of week (1-7, 1=mon)
%b short month name      %B month name           %Z timezone name
%j day of year (001-366) %d day of month (01-31) %e day of month ( 1-31)
%N nanosec (output only)

%U Week of year (0-53 start Sunday)   %W Week of year (0-53 start Monday)
%V Week of year (1-53 start Monday, week < 4 days not part of this year)

%F "%Y-%m-%d"   %R "%H:%M"        %T "%H:%M:%S"        %z  timezone (-0800)
%D "%m/%d/%y"   %r "%I:%M:%S %p"  %h "%b"              %:z timezone (-08:00)
%x locale date  %X locale time    %c locale date/time  %s  unix epoch timeusage: dd [if=FILE] [of=FILE] [ibs=N] [obs=N] [iflag=FLAGS] [oflag=FLAGS]
        [bs=N] [count=N] [seek=N] [skip=N]
        [conv=notrunc|noerror|sync|fsync] [status=noxfer|none]

Copy/convert files.

if=FILE		Read from FILE instead of stdin
of=FILE		Write to FILE instead of stdout
bs=N		Read and write N bytes at a time
ibs=N		Input block size
obs=N		Output block size
count=N		Copy only N input blocks
skip=N		Skip N input blocks
seek=N		Skip N output blocks
iflag=FLAGS	Set input flags
oflag=FLAGS	Set output flags
conv=notrunc	Don't truncate output file
conv=noerror	Continue after read errors
conv=sync	Pad blocks with zeros
conv=fsync	Physically write data out before finishing
status=noxfer	Don't show transfer rate
status=none	Don't show transfer rate or records in/out

FLAGS is a comma-separated list of:

count_bytes	(iflag) interpret count=N in bytes, not blocks
seek_bytes	(oflag) interpret seek=N in bytes, not blocks
skip_bytes	(iflag) interpret skip=N in bytes, not blocks

Numbers may be suffixed by c (*1), w (*2), b (*512), kD (*1000), k (*1024),
MD (*1000*1000), M (*1024*1024), GD (*1000*1000*1000) or G (*1024*1024*1024).usage: devmem ADDR [WIDTH [DATA]]

Read/write physical address. WIDTH is 1, 2, 4, or 8 bytes (default 4).
Prefix ADDR with 0x for hexadecimal, output is in same base as address.usage: df [-HPkhi] [-t type] [FILE...]

The "disk free" command shows total/used/available disk space for
each filesystem listed on the command line, or all currently mounted
filesystems.

-a	Show all (including /proc and friends)
-P	The SUSv3 "Pedantic" option
-k	Sets units back to 1024 bytes (the default without -P)
-h	Human readable (K=1024)
-H	Human readable (k=1000)
-i	Show inodes instead of blocks
-t type	Display only filesystems of this type

Pedantic provides a slightly less useful output format dictated by POSIX,
and sets the units to 512 bytes instead of the default 1024 bytes.usage: diff [-abBdiNqrTstw] [-L LABEL] [-S FILE] [-U LINES] FILE1 FILE2

-a	Treat all files as text
-b	Ignore changes in the amount of whitespace
-B	Ignore changes whose lines are all blank
-d	Try hard to find a smaller set of changes
-i	Ignore case differences
-L	Use LABEL instead of the filename in the unified header
-N	Treat absent files as empty
-q	Output only whether files differ
-r	Recurse
-S	Start with FILE when comparing directories
-T	Make tabs line up by prefixing a tab when necessary
-s	Report when two files are the same
-t	Expand tabs to spaces in output
-u	Unified diff
-U	Output LINES lines of context
-w	Ignore all whitespace

--color              Colored output
--strip-trailing-cr  Strip trailing '\r's from input linesusage: dirname PATH...

Show directory portion of path.usage: dmesg [-Cc] [-r|-t|-T] [-n LEVEL] [-s SIZE] [-w]

Print or control the kernel ring buffer.

-C	Clear ring buffer without printing
-c	Clear ring buffer after printing
-n	Set kernel logging LEVEL (1-9)
-r	Raw output (with )
-S	Use syslog(2) rather than /dev/kmsg
-s	Show the last SIZE many bytes
-T	Human readable timestamps
-t	Don't print timestamps
-w	Keep waiting for more output (aka --follow)usage: dos2unix [FILE...]

Convert newline format from dos "\r\n" to unix "\n".
If no files listed copy from stdin, "-" is a synonym for stdin.usage: du [-d N] [-askxHLlmc] [FILE...]

Show disk usage, space consumed by files and directories.

Size in:
-b	Apparent bytes (directory listing size, not space used)
-k	1024 byte blocks (default)
-K	512 byte blocks (posix)
-m	Megabytes
-h	Human readable (e.g., 1K 243M 2G)

What to show:
-a	All files, not just directories
-H	Follow symlinks on cmdline
-L	Follow all symlinks
-s	Only total size of each argument
-x	Don't leave this filesystem
-c	Cumulative total
-d N	Only depth < N
-l	Disable hardlink filterusage: echo [-neE] [ARG...]

Write each argument to stdout, with one space between each, followed
by a newline.

-n	No trailing newline
-E	Print escape sequences literally (default)
-e	Process the following escape sequences:
	\\	Backslash
	\0NNN	Octal values (1 to 3 digits)
	\a	Alert (beep/flash)
	\b	Backspace
	\c	Stop output here (avoids trailing newline)
	\f	Form feed
	\n	Newline
	\r	Carriage return
	\t	Horizontal tab
	\v	Vertical tab
	\xHH	Hexadecimal values (1 to 2 digits)grepusage: env [-i] [-u NAME] [NAME=VALUE...] [COMMAND...]

Set the environment for command invocation, or list environment variables.

-i	Clear existing environment
-u NAME	Remove NAME from the environment
-0	Use null instead of newline in outputusage: expand [-t TABLIST] [FILE...]

Expand tabs to spaces according to tabstops.

-t	TABLIST

Specify tab stops, either a single number instead of the default 8,
or a comma separated list of increasing numbers representing tabstop
positions (absolute, not increments) with each additional tab beyond
that becoming one space.usage: expr ARG1 OPERATOR ARG2...

Evaluate expression and print result. For example, "expr 1 + 2".

The supported operators are (grouped from highest to lowest priority):

  ( )    :    * / %    + -    != <= < >= > =    &    |

Each constant and operator must be a separate command line argument.
All operators are infix, meaning they expect a constant (or expression
that resolves to a constant) on each side of the operator. Operators of
the same priority (within each group above) are evaluated left to right.
Parentheses may be used (as separate arguments) to elevate the priority
of expressions.

Calling expr from a command shell requires a lot of \( or '*' escaping
to avoid interpreting shell control characters.

The & and | operators are logical (not bitwise) and may operate on
strings (a blank string is "false"). Comparison operators may also
operate on strings (alphabetical sort).

Constants may be strings or integers. Comparison, logical, and regex
operators may operate on strings (a blank string is "false"), other
operators require integers.usage: fallocate [-l size] [-o offset] file

Tell the filesystem to allocate space for a file.usage: false

Return nonzero.grepusage: file [-bhLs] [FILE...]

Examine the given files and describe their content types.

-b	Brief (no filename)
-h	Don't follow symlinks (default)
-L	Follow symlinks
-s	Show block/char device contentsusage: find [-HL] [DIR...] []

Search directories for matching files.
Default: search ".", match all, -print matches.

-H  Follow command line symlinks         -L  Follow all symlinks

Match filters:
-name  PATTERN   filename with wildcards  (-iname case insensitive)
-path  PATTERN   path name with wildcards (-ipath case insensitive)
-user  UNAME     belongs to user UNAME     -nouser     user ID not known
-group GROUP     belongs to group GROUP    -nogroup    group ID not known
-perm  [-/]MODE  permissions (-=min /=any) -prune      ignore dir contents
-size  N[c]      512 byte blocks (c=bytes) -xdev       only this filesystem
-links N         hardlink count            -atime N[u] accessed N units ago
-ctime N[u]      created N units ago       -mtime N[u] modified N units ago
-newer FILE      newer mtime than FILE     -mindepth N at least N dirs down
-depth           ignore contents of dir    -maxdepth N at most N dirs down
-inum N          inode number N            -empty      empty files and dirs
-type [bcdflps]  type is (block, char, dir, file, symlink, pipe, socket)
-true            always true               -false      always false
-context PATTERN security context          -executable access(X_OK) perm+ACL
-newerXY FILE    X=acm time > FILE's Y=acm time (Y=t: FILE is literal time)

Numbers N may be prefixed by a - (less than) or + (greater than). Units for
-Xtime are d (days, default), h (hours), m (minutes), or s (seconds).

Combine matches with:
!, -a, -o, ( )    not, and, or, group expressions

Actions:
-print  Print match with newline  -print0        Print match with null
-exec   Run command with path     -execdir       Run command in file's dir
-ok     Ask before exec           -okdir         Ask before execdir
-delete Remove matching file/dir  -printf FORMAT Print using format string

Commands substitute "{}" with matched file. End with ";" to run each file,
or "+" (next argument after "{}") to collect and run with multiple files.

-printf FORMAT characters are \ escapes and:
%b  512 byte blocks used
%f  basename            %g  textual gid          %G  numeric gid
%i  decimal inode       %l  target of symlink    %m  octal mode
%M  ls format type/mode %p  path to file         %P  path to file minus DIR
%s  size in bytes       %T@ mod time as unixtime
%u  username            %U  numeric uid          %Z  security contextusage: flock [-sxun] fd

Manage advisory file locks.

-s	Shared lock
-x	Exclusive lock (default)
-u	Unlock
-n	Non-blocking: fail rather than wait for the lockusage: fmt [-w WIDTH] [FILE...]

Reformat input to wordwrap at a given line length, preserving existing
indentation level, writing to stdout.

-w WIDTH	Maximum characters per line (default 75)usage: free [-bkmgt]

Display the total, free and used amount of physical memory and swap space.

-bkmgt	Output units (default is bytes)
-h	Human readable (K=1024)usage: freeramdisk [RAM device]

Free all memory allocated to specified ramdiskusage: fsfreeze {-f | -u} MOUNTPOINT

Freeze or unfreeze a filesystem.

-f	Freeze
-u	Unfreezeusage: fsync [-d] [FILE...]

Synchronize a file's in-core state with storage device.

-d	Avoid syncing metadatausage: getconf -a [PATH] | -l | NAME [PATH]

Get system configuration values. Values from pathconf(3) require a path.

-a	Show all (defaults to "/" if no path given)
-l	List available value names (grouped by source)usage: getenforce

Shows whether SELinux is disabled, enforcing, or permissive.usage: getfattr [-d] [-h] [-n NAME] FILE...

Read POSIX extended attributes.

-d	Show values as well as names
-h	Do not dereference symbolic links
-n	Show only attributes with the given name
--only-values	Don't show namesusage: getopt [OPTIONS] [--] ARG...

Parse command-line options for use in shell scripts.

-a	Allow long options starting with a single -.
-l OPTS	Specify long options.
-n NAME	Command name for error messages.
-o OPTS	Specify short options.
-T	Test whether this is a modern getopt.
-u	Output options unquoted.usage: grep [-EFrivwcloqsHbhn] [-ABC NUM] [-m MAX] [-e REGEX]... [-MS PATTERN]... [-f REGFILE] [FILE]...

Show lines matching regular expressions. If no -e, first argument is
regular expression to match. With no files (or "-" filename) read stdin.
Returns 0 if matched, 1 if no match found, 2 for command errors.

-e  Regex to match. (May be repeated.)
-f  File listing regular expressions to match.

file search:
-r  Recurse into subdirectories (defaults FILE to ".")
-R  Recurse into subdirectories and symlinks to directories
-M  Match filename pattern (--include)
-S  Skip filename pattern (--exclude)
--exclude-dir=PATTERN  Skip directory pattern
-I  Ignore binary files

match type:
-A  Show NUM lines after     -B  Show NUM lines before match
-C  NUM lines context (A+B)  -E  extended regex syntax
-F  fixed (literal match)    -a  always text (not binary)
-i  case insensitive         -m  match MAX many lines
-v  invert match             -w  whole word (implies -E)
-x  whole line               -z  input NUL terminated

display modes: (default: matched line)
-c  count of matching lines  -l  show only matching filenames
-o  only matching part       -q  quiet (errors only)
-s  silent (no error msg)    -Z  output NUL terminated

output prefix (default: filename if checking more than 1 file)
-H  force filename           -b  byte offset of match
-h  hide filename            -n  line number of matchusage: groups [user]

Print the groups a user is in.usage: gunzip [-cfk] [FILE...]

Decompress files. With no files, decompresses stdin to stdout.
On success, the input files are removed and replaced by new
files without the .gz suffix.

-c	Output to stdout (act as zcat)
-f	Force: allow read from tty
-k	Keep input files (default is to remove)usage: gzip [-19cdfk] [FILE...]

Compress files. With no files, compresses stdin to stdout.
On success, the input files are removed and replaced by new
files with the .gz suffix.

-c	Output to stdout
-d	Decompress (act as gunzip)
-f	Force: allow overwrite of output file
-k	Keep input files (default is to remove)
-#	Compression level 1-9 (1:fastest, 6:default, 9:best)usage: head [-n NUM] [FILE...]

Copy first lines from files to stdout. If no files listed, copy from
stdin. Filename "-" is a synonym for stdin.

-n	Number of lines to copy
-c	Number of bytes to copy
-q	Never print headers
-v	Always print headersusage: help [-ahu] [COMMAND]

-a	All commands
-u	Usage only
-h	HTML output

Show usage information for toybox commands.
Run "toybox" with no arguments for a list of available commands.usage: hostname [-bdsf] [-F FILENAME] [newname]

Get/set the current hostname.

-b	Set hostname to 'localhost' if otherwise unset
-d	Show DNS domain name (no host)
-f	Show fully-qualified name (host+domain, FQDN)
-F	Set hostname to contents of FILENAME
-s	Show short host name (no domain)usage: hwclock [-rswtluf]

Get/set the hardware clock.

-f FILE	Use specified device file instead of /dev/rtc0 (--rtc)
-l	Hardware clock uses localtime (--localtime)
-r	Show hardware clock time (--show)
-s	Set system time from hardware clock (--hctosys)
-t	Set the system time based on the current timezone (--systz)
-u	Hardware clock uses UTC (--utc)
-w	Set hardware clock from system time (--systohc)usage: i2cdetect [-ary] BUS [FIRST LAST]
usage: i2cdetect -F BUS
usage: i2cdetect -l

Detect i2c devices.

-a	All addresses (0x00-0x7f rather than 0x03-0x77)
-F	Show functionality
-l	List all buses
-r	Probe with SMBus Read Byte
-y	Answer "yes" to confirmation prompts (for script use)usage: i2cdump [-fy] BUS CHIP

Dump i2c registers.

-f	Force access to busy devices
-y	Answer "yes" to confirmation prompts (for script use)usage: i2cget [-fy] BUS CHIP ADDR

Read an i2c register.

-f	Force access to busy devices
-y	Answer "yes" to confirmation prompts (for script use)usage: i2cset [-fy] BUS CHIP ADDR VALUE... MODE

Write an i2c register. MODE is b for byte, w for 16-bit word, i for I2C block.

-f	Force access to busy devices
-y	Answer "yes" to confirmation prompts (for script use)usage: iconv [-f FROM] [-t TO] [FILE...]

Convert character encoding of files.

-c	Omit invalid chars
-f	Convert from (default UTF-8)
-t	Convert to   (default UTF-8)usage: id [-GZgnru] [USER...]

Print user and group ID.
-G	Show all group IDs
-Z	Show only security context
-g	Show only the effective group ID
-n	Print names instead of numeric IDs (to be used with -Ggu)
-r	Show real ID instead of effective ID
-u	Show only the effective user IDusage: ifconfig [-aS] [INTERFACE [ACTION...]]

Display or configure network interface.

With no arguments, display active interfaces. First argument is interface
to operate on, one argument by itself displays that interface.

-a	All interfaces displayed, not just active ones
-S	Short view, one line per interface

Standard ACTIONs to perform on an INTERFACE:

ADDR[/MASK]        - set IPv4 address (1.2.3.4/5) and activate interface
add|del ADDR[/LEN] - add/remove IPv6 address (1111::8888/128)
up|down            - activate or deactivate interface

Advanced ACTIONs (default values usually suffice):

default          - remove IPv4 address
netmask ADDR     - set IPv4 netmask via 255.255.255.0 instead of /24
txqueuelen LEN   - number of buffered packets before output blocks
mtu LEN          - size of outgoing packets (Maximum Transmission Unit)
broadcast ADDR   - Set broadcast address
pointopoint ADDR - PPP and PPPOE use this instead of "route add default gw"
hw TYPE ADDR     - set hardware (mac) address (type = ether|infiniband)

Flags you can set on an interface (or -remove by prefixing with -):

arp       - don't use Address Resolution Protocol to map LAN routes
promisc   - don't discard packets that aren't to this LAN hardware address
multicast - force interface into multicast mode if the driver doesn't
allmulti  - promisc for multicast packetsusage: inotifyd PROG FILE[:MASK] ...

When a filesystem event matching MASK occurs to a FILE, run PROG as:

  PROG EVENTS FILE [DIRFILE]

If PROG is "-" events are sent to stdout.

This file is:
  a  accessed    c  modified    e  metadata change  w  closed (writable)
  r  opened      D  deleted     M  moved            0  closed (unwritable)
  u  unmounted   o  overflow    x  unwatchable

A file in this directory is:
  m  moved in    y  moved out   n  created          d  deleted

When x event happens for all FILEs, inotifyd exits (after waiting for PROG).usage: insmod MODULE [MODULE_OPTIONS]

Load the module named MODULE passing options if given.usage: install [-dDpsv] [-o USER] [-g GROUP] [-m MODE] [-t TARGET] [SOURCE...] [DEST]

Copy files and set attributes.

-d	Act like mkdir -p
-D	Create leading directories for DEST
-g	Make copy belong to GROUP
-m	Set permissions to MODE
-o	Make copy belong to USER
-p	Preserve timestamps
-s	Call "strip -p"
-t	Copy files to TARGET dir (no DEST)
-v	Verboseusage: ionice [-t] [-c CLASS] [-n LEVEL] [COMMAND...|-p PID]

Change the I/O scheduling priority of a process. With no arguments
(or just -p), display process' existing I/O class/priority.

-c	CLASS = 1-3: 1(realtime), 2(best-effort, default), 3(when-idle)
-n	LEVEL = 0-7: (0 is highest priority, default = 5)
-p	Affect existing PID instead of spawning new child
-t	Ignore failure to set I/O priority

System default iopriority is generally -c 2 -n 4.usage: iorenice PID [CLASS] [PRIORITY]

Display or change I/O priority of existing process. CLASS can be
"rt" for realtime, "be" for best effort, "idle" for only when idle, or
"none" to leave it alone. PRIORITY can be 0-7 (0 is highest, default 4).usage: iotop [-AaKObq] [-n NUMBER] [-d SECONDS] [-p PID,] [-u USER,]

Rank processes by I/O.

-A	All I/O, not just disk
-a	Accumulated I/O (not percentage)
-H	Show threads
-K	Kilobytes
-k	Fallback sort FIELDS (default -[D]IO,-ETIME,-PID)
-m	Maximum number of tasks to show
-O	Only show processes doing I/O
-o	Show FIELDS (default PID,PR,USER,[D]READ,[D]WRITE,SWAP,[D]IO,COMM)
-s	Sort by field number (0-X, default 6)
-b	Batch mode (no tty)
-d	Delay SECONDS between each cycle (default 3)
-n	Exit after NUMBER iterations
-p	Show these PIDs
-u	Show these USERs
-q	Quiet (no header lines)

Cursor LEFT/RIGHT to change sort, UP/DOWN move list, space to force
update, R to reverse sort, Q to exit.usage: kill [-l [SIGNAL] | -s SIGNAL | -SIGNAL] PID...

Send signal to process(es).

-l	List signal name(s) and number(s)
-s	Send SIGNAL (default SIGTERM)usage: killall [-l] [-iqv] [-SIGNAL|-s SIGNAL] PROCESS_NAME...

Send a signal (default: TERM) to all processes with the given names.

-i	Ask for confirmation before killing
-l	Print list of all available signals
-q	Don't print any warnings or error messages
-s	Send SIGNAL instead of SIGTERM
-v	Report if the signal was successfully sent
-w	Wait until all signaled processes are deadusage: ln [-sfnv] [-t DIR] [FROM...] TO

Create a link between FROM and TO.
One/two/many arguments work like "mv" or "cp".

-s	Create a symbolic link
-f	Force the creation of the link, even if TO already exists
-n	Symlink at TO treated as file
-r	Create relative symlink from -> to
-t	Create links in DIR
-T	TO always treated as file, max 2 arguments
-v	Verboseusage: load_policy FILE

Load the specified SELinux policy file.usage: log [-p PRI] [-t TAG] MESSAGE...

Logs message to logcat.

-p	Use the given priority instead of INFO:
	d: DEBUG  e: ERROR  f: FATAL  i: INFO  v: VERBOSE  w: WARN  s: SILENT
-t	Use the given tag instead of "log"usage: logname

Print the current user name.usage: losetup [-cdrs] [-o OFFSET] [-S SIZE] {-d DEVICE...|-j FILE|-af|{DEVICE FILE}}

Associate a loopback device with a file, or show current file (if any)
associated with a loop device.

Instead of a device:
-a	Iterate through all loopback devices
-f	Find first unused loop device (may create one)
-j FILE	Iterate through all loopback devices associated with FILE

existing:
-c	Check capacity (file size changed)
-d DEV	Detach loopback device
-D	Detach all loopback devices

new:
-s	Show device name (alias --show)
-o OFF	Start association at offset OFF into FILE
-r	Read only
-S SIZE	Limit SIZE of loopback association (alias --sizelimit)usage: ls [-ACFHLRSZacdfhiklmnpqrstuwx1] [--color[=auto]] [FILE...]

List files.

what to show:
-a  all files including .hidden    -b  escape nongraphic chars
-c  use ctime for timestamps       -d  directory, not contents
-i  inode number                   -p  put a '/' after dir names
-q  unprintable chars as '?'       -s  storage used (1024 byte units)
-u  use access time for timestamps -A  list all files but . and ..
-H  follow command line symlinks   -L  follow symlinks
-R  recursively list in subdirs    -F  append /dir *exe @sym |FIFO
-Z  security context

output formats:
-1  list one file per line         -C  columns (sorted vertically)
-g  like -l but no owner           -h  human readable sizes
-l  long (show full details)       -m  comma separated
-n  like -l but numeric uid/gid    -o  like -l but no group
-w  set column width               -x  columns (horizontal sort)
-ll long with nanoseconds (--full-time)
--color  device=yellow  symlink=turquoise/red  dir=blue  socket=purple
         files: exe=green  suid=red  suidfile=redback  stickydir=greenback
         =auto means detect if output is a tty.

sorting (default is alphabetical):
-f  unsorted    -r  reverse    -t  timestamp    -S  sizeusage: lsattr [-Radlpv] [FILE...]

List file attributes on a Linux file system.
Flag letters are defined in chattr help.

-R	Recursively list attributes of directories and their contents
-a	List all files in directories, including files that start with '.'
-d	List directories like other files, rather than listing their contents
-l	List long flag names
-p	List the file's project number
-v	List the file's version/generation numberusage: lsmod

Display the currently loaded modules, their sizes and their dependencies.usage: lsof [-lt] [-p PID1,PID2,...] [FILE...]

List all open files belonging to all active processes, or processes using
listed FILE(s).

-l	list uids numerically
-p	for given comma-separated pids only (default all pids)
-t	terse (pid only) outputusage: lspci [-ekm]

List PCI devices.

-e	Print all 6 digits in class
-k	Print kernel driver
-m	Machine readable formatusage: lsusb

List USB hosts/devices.usage: makedevs [-d device_table] rootdir

Create a range of special files as specified in a device table.

-d	File containing device table (default reads from stdin)

Each line of the device table has the fields:
         
Where name is the file name, and type is one of the following:

b	Block device
c	Character device
d	Directory
f	Regular file
p	Named pipe (fifo)

Other fields specify permissions, user and group id owning the file,
and additional fields for device special files. Use '-' for blank entries,
unspecified fields are treated as '-'.usage: md5sum [-bcs] [FILE]...

Calculate md5 hash for each input file, reading from stdin if none.
Output one hash (32 hex digits) for each input file, followed by filename.

-b	Brief (hash only, no filename)
-c	Check each line of each FILE is the same hash+filename we'd output
-s	No output, exit status 0 if all hashes match, 1 otherwiseusage: microcom [-s SPEED] [-X] DEVICE

Simple serial console.

-s	Set baud rate to SPEED (default 115200)
-X	Ignore ^@ (send break) and ^] (exit)usage: mkdir [-vp] [-m MODE] [DIR...]

Create one or more directories.

-m	Set permissions of directory to mode
-p	Make parent directories as needed
-v	Verboseusage: mkfifo [-Z CONTEXT] [NAME...]

Create FIFOs (named pipes).

-Z	Security contextusage: mknod [-m MODE] NAME TYPE [MAJOR MINOR]

Create a special file NAME with a given type. TYPE is b for block device,
c or u for character device, p for named pipe (which ignores MAJOR/MINOR).

-m	Mode (file permissions) of new device, in octal or u+x formatusage: mkswap [-L LABEL] DEVICE

Set up a Linux swap area on a device or file.usage: mktemp [-dqu] [-p DIR] [TEMPLATE]

Safely create a new file "DIR/TEMPLATE" and print its name.

-d	Create directory instead of file (--directory)
-p	Put new file in DIR (--tmpdir)
-q	Quiet, no error messages
-t	Prefer $TMPDIR > DIR > /tmp (default DIR > $TMPDIR > /tmp)
-u	Don't create anything, just print what would be created

Each X in TEMPLATE is replaced with a random printable character. The
default TEMPLATE is tmp.XXXXXXXXXX.usage: modinfo [-0] [-b basedir] [-k kernel] [-F field] [module|file...]

Display module fields for modules specified by name or .ko path.

-F  Only show the given field
-0  Separate fields with NUL rather than newline
-b  Use  as root for /lib/modules/
-k  Look in given directory under /lib/modules/usage: modprobe [-alrqvsDb] [-d DIR] MODULE [symbol=value][...]

modprobe utility - inserts modules and dependencies.

-a  Load multiple MODULEs
-d  Load modules from DIR, option may be used multiple times
-l  List (MODULE is a pattern)
-r  Remove MODULE (stacks) or do autoclean
-q  Quiet
-v  Verbose
-s  Log to syslog
-D  Show dependencies
-b  Apply blacklist to module names toousage: more [FILE...]

View FILE(s) (or stdin) one screenfull at a time.usage: mount [-afFrsvw] [-t TYPE] [-o OPTION,] [[DEVICE] DIR]

Mount new filesystem(s) on directories. With no arguments, display existing
mounts.

-a	Mount all entries in /etc/fstab (with -t, only entries of that TYPE)
-O	Only mount -a entries that have this option
-f	Fake it (don't actually mount)
-r	Read only (same as -o ro)
-w	Read/write (default, same as -o rw)
-t	Specify filesystem type
-v	Verbose

OPTIONS is a comma separated list of options, which can also be supplied
as --longopts.

Autodetects loopback mounts (a file on a directory) and bind mounts (file
on file, directory on directory), so you don't need to say --bind or --loop.
You can also "mount -a /path" to mount everything in /etc/fstab under /path,
even if it's noauto. DEVICE starting with UUID= is identified by blkid -U.usage: mountpoint [-qd] DIR
       mountpoint [-qx] DEVICE

Check whether the directory or device is a mountpoint.

-q	Be quiet, return zero if directory is a mountpoint
-d	Print major/minor device number of the directory
-x	Print major/minor device number of the block deviceusage: mv [-finTv] [-t TARGET] SOURCE... [DEST]

-f	Force copy by deleting destination file
-i	Interactive, prompt before overwriting existing DEST
-n	No clobber (don't overwrite DEST)
-t	Move to TARGET dir (no DEST)
-T	DEST always treated as file, max 2 arguments
-v	Verbosenbd_clientusage: nbd-client [-ns] HOST PORT DEVICE

-n	Do not fork into background
-s	nbd swap support (lock server into memory)netcatusage: netcat [-46ELUlt] [-u] [-wpq #] [-s addr] {IPADDR PORTNUM|-f FILENAME|COMMAND...}

Forward stdin/stdout to a file or network connection.

-4	Force IPv4
-6	Force IPv6
-E	Forward stderr
-L	Listen and background each incoming connection (server mode)
-U	Use a UNIX domain socket
-W	SECONDS timeout for more data on an idle connection
-f	Use FILENAME (ala /dev/ttyS0) instead of network
-l	Listen for one incoming connection, then exit
-p	Local port number
-q	Quit SECONDS after EOF on stdin, even if stdout hasn't closed yet
-s	Local source address
-t	Allocate tty
-u	Use UDP
-w	SECONDS timeout to establish connection

Use "stty 115200 -F /dev/ttyS0 && stty raw -echo -ctlecho" with
netcat -f to connect to a serial port.

When listening the COMMAND line is executed as a child process to handle
an incoming connection. With no COMMAND -l forwards the connection
to stdin/stdout. If no -p specified, -l prints the port it bound to and
backgrounds itself (returning immediately).

For a quick-and-dirty server, try something like:
netcat -s 127.0.0.1 -p 1234 -tL sh -lusage: netstat [-pWrxwutneal]

Display networking information. Default is netstat -tuwx

-r	Routing table
-a	All sockets (not just connected)
-l	Listening server sockets
-t	TCP sockets
-u	UDP sockets
-w	Raw sockets
-x	Unix sockets
-e	Extended info
-n	Don't resolve names
-W	Wide display
-p	Show PID/program name of socketsusage: nice [-n PRIORITY] COMMAND...

Run a command line at an increased or decreased scheduling priority.

Higher numbers make a program yield more CPU time, from -20 (highest
priority) to 19 (lowest).  By default processes inherit their parent's
niceness (usually 0).  By default this command adds 10 to the parent's
priority.  Only root can set a negative niceness level.usage: nl [-E] [-l #] [-b MODE] [-n STYLE] [-s SEPARATOR] [-v #] [-w WIDTH] [FILE...]

Number lines of input.

-E	Use extended regex syntax (when doing -b pREGEX)
-b	Which lines to number: a (all) t (non-empty, default) pREGEX (pattern)
-l	Only count last of this many consecutive blank lines
-n	Number STYLE: ln (left justified) rn (right justified) rz (zero pad)
-s	Separator to use between number and line (instead of TAB)
-v	Starting line number for each section (default 1)
-w	Width of line numbers (default 6)usage: nohup COMMAND...

Run a command that survives the end of its terminal.

Redirect tty on stdin to /dev/null, tty on stdout to "nohup.out".usage: nproc [--all]

Print number of processors.

--all	Show all processors, not just ones this task can run onusage: nsenter [-t pid] [-F] [-i] [-m] [-n] [-p] [-u] [-U] COMMAND...

Run COMMAND in an existing (set of) namespace(s).

-t	PID to take namespaces from    (--target)
-F	don't fork, even if -p is used (--no-fork)

The namespaces to switch are:

-i	SysV IPC: message queues, semaphores, shared memory (--ipc)
-m	Mount/unmount tree (--mount)
-n	Network address, sockets, routing, iptables (--net)
-p	Process IDs and init, will fork unless -F is used (--pid)
-u	Host and domain names (--uts)
-U	UIDs, GIDs, capabilities (--user)

If -t isn't specified, each namespace argument must provide a path
to a namespace file, ala "-i=/proc/$PID/ns/ipc"usage: od [-bcdosxv] [-j #] [-N #] [-w #] [-A doxn] [-t acdfoux[#]]

Dump data in octal/hex.

-A	Address base (decimal, octal, hexadecimal, none)
-j	Skip this many bytes of input
-N	Stop dumping after this many bytes
-t	Output type a(scii) c(har) d(ecimal) f(loat) o(ctal) u(nsigned) (he)x
	plus optional size in bytes
	aliases: -b=-t o1, -c=-t c, -d=-t u2, -o=-t o2, -s=-t d2, -x=-t x2
-v	Don't collapse repeated lines together
-w	Total line width in bytes (default 16)usage: partprobe DEVICE...

Tell the kernel about partition table changes

Ask the kernel to re-read the partition table on the specified devices.usage: paste [-s] [-d DELIMITERS] [FILE...]

Merge corresponding lines from each input file.

-d	List of delimiter characters to separate fields with (default is \t)
-s	Sequential mode: turn each input file into one line of outputusage: patch [-d DIR] [-i PATCH] [-p DEPTH] [-F FUZZ] [-Rlsu] [--dry-run] [FILE [PATCH]]

Apply a unified diff to one or more files.

-d	Modify files in DIR
-i	Input patch file (default=stdin)
-l	Loose match (ignore whitespace)
-p	Number of '/' to strip from start of file paths (default=all)
-R	Reverse patch
-s	Silent except for errors
-u	Ignored (only handles "unified" diffs)
--dry-run Don't change files, just confirm patch applies

This version of patch only handles unified diffs, and only modifies
a file when all hunks to that file apply. Patch prints failed hunks
to stderr, and exits with nonzero status if any hunks fail.

A file compared against /dev/null (or with a date <= the epoch) is
created/deleted as appropriate.usage: pgrep [-clfnovx] [-d DELIM] [-L SIGNAL] [PATTERN] [-G GID,] [-g PGRP,] [-P PPID,] [-s SID,] [-t TERM,] [-U UID,] [-u EUID,]

Search for process(es). PATTERN is an extended regular expression checked
against command names.

-c	Show only count of matches
-d	Use DELIM instead of newline
-L	Send SIGNAL instead of printing name
-l	Show command name
-f	Check full command line for PATTERN
-G	Match real Group ID(s)
-g	Match Process Group(s) (0 is current user)
-n	Newest match only
-o	Oldest match only
-P	Match Parent Process ID(s)
-s	Match Session ID(s) (0 for current)
-t	Match Terminal(s)
-U	Match real User ID(s)
-u	Match effective User ID(s)
-v	Negate the match
-x	Match whole command (not substring)usage: pidof [-s] [-o omitpid[,omitpid...]] [NAME]...

Print the PIDs of all processes with the given names.

-s	Single shot, only return one pid
-o	Omit PID(s)
-x	Match shell scripts toousage: ping [OPTIONS] HOST

Check network connectivity by sending packets to a host and reporting
its response.

Send ICMP ECHO_REQUEST packets to ipv4 or ipv6 addresses and prints each
echo it receives back, with round trip time. Returns true if host alive.

Options:
-4, -6		Force IPv4 or IPv6
-c CNT		Send CNT many packets (default 3, 0 = infinite)
-f		Flood (print . and \b to show drops, default -c 15 -i 0.2)
-i TIME		Interval between packets (default 1, need root for < .2)
-I IFACE/IP	Source interface or address
-m MARK		Tag outgoing packets using SO_MARK
-q		Quiet (stops after one returns true if host is alive)
-s SIZE		Data SIZE in bytes (default 56)
-t TTL		Set Time To Live (number of hops)
-W SEC		Seconds to wait for response after last -c packet (default 3)
-w SEC		Exit after this many secondspingusage: pivot_root OLD NEW

Swap OLD and NEW filesystems (as if by simultaneous mount --move), and
move all processes with chdir or chroot under OLD into NEW (including
kernel threads) so OLD may be unmounted.

The directory NEW must exist under OLD. This doesn't work on initramfs,
which can't be moved (about the same way PID 1 can't be killed; see
switch_root instead).usage: pkill [-fnovx] [-SIGNAL|-l SIGNAL] [PATTERN] [-G GID,] [-g PGRP,] [-P PPID,] [-s SID,] [-t TERM,] [-U UID,] [-u EUID,]

-l	Send SIGNAL (default SIGTERM)
-V	Verbose
-f	Check full command line for PATTERN
-G	Match real Group ID(s)
-g	Match Process Group(s) (0 is current user)
-n	Newest match only
-o	Oldest match only
-P	Match Parent Process ID(s)
-s	Match Session ID(s) (0 for current)
-t	Match Terminal(s)
-U	Match real User ID(s)
-u	Match effective User ID(s)
-v	Negate the match
-x	Match whole command (not substring)usage: pmap [-xq] [pids...]

Report the memory map of a process or processes.

-x	Show the extended format
-q	Do not display some header/footer linesusage: printenv [-0] [env_var...]

Print environment variables.

-0	Use \0 as delimiter instead of \nusage: printf FORMAT [ARGUMENT...]

Format and print ARGUMENT(s) according to FORMAT, using C printf syntax
(% escapes for cdeEfgGiosuxX, \ escapes for abefnrtv0 or \OCTAL or \xHEX).ulimitusage: ps [-AadefLlnwZ] [-gG GROUP,] [-k FIELD,] [-o FIELD,] [-p PID,] [-t TTY,] [-uU USER,]

List processes.

Which processes to show (-gGuUpPt selections may be comma separated lists):

-A  All					-a  Has terminal not session leader
-d  All but session leaders		-e  Synonym for -A
-g  In GROUPs				-G  In real GROUPs (before sgid)
-p  PIDs (--pid)			-P  Parent PIDs (--ppid)
-s  In session IDs			-t  Attached to selected TTYs
-T  Show threads also			-u  Owned by selected USERs
-U  Real USERs (before suid)

Output modifiers:

-k  Sort FIELDs (-FIELD to reverse)	-M  Measure/pad future field widths
-n  Show numeric USER and GROUP		-w  Wide output (don't truncate fields)

Which FIELDs to show. (-o HELP for list, default = -o PID,TTY,TIME,CMD)

-f  Full listing (-o USER:12=UID,PID,PPID,C,STIME,TTY,TIME,ARGS=CMD)
-l  Long listing (-o F,S,UID,PID,PPID,C,PRI,NI,ADDR,SZ,WCHAN,TTY,TIME,CMD)
-o  Output FIELDs instead of defaults, each with optional :size and =title
-O  Add FIELDS to defaults
-Z  Include LABELusage: pwd [-L|-P]

Print working (current) directory.

-L	Use shell's path from $PWD (when applicable)
-P	Print canonical absolute pathusage: pwdx PID...

Print working directory of processes listed on command line.usage: readelf [-adehlnSs] [-p SECTION] [-x SECTION] [file...]

Displays information about ELF files.

-a	Equivalent to -dhlnSs
-d	Show dynamic section
-e	Headers (equivalent to -hlS)
-h	Show ELF header
-l	Show program headers
-n	Show notes
-p S	Dump strings found in named/numbered section
-S	Show section headers
-s	Show symbol tables (.dynsym and .symtab)
-x S	Hex dump of named/numbered section

--dyn-syms	Show just .dynsym symbol tableusage: readlink FILE...

With no options, show what symlink points to, return error if not symlink.

Options for producing canonical paths (all symlinks/./.. resolved):

-e	Canonical path to existing entry (fail if missing)
-f	Full path (fail if directory missing)
-m	Ignore missing entries, show where it would be
-n	No trailing newline
-q	Quiet (no output, just error code)usage: realpath FILE...

Display the canonical absolute pathnameusage: renice [-gpu] -n INCREMENT ID...usage: restorecon [-D] [-F] [-R] [-n] [-v] FILE...

Restores the default security contexts for the given files.

-D	Apply to /data/data too
-F	Force reset
-R	Recurse into directories
-n	Don't make any changes; useful with -v to see what would change
-v	Verboseusage: rev [FILE...]

Output each line reversed, when no files are given stdin is used.usage: rfkill COMMAND [DEVICE]

Enable/disable wireless devices.

Commands:
list [DEVICE]   List current state
block DEVICE    Disable device
unblock DEVICE  Enable device

DEVICE is an index number, or one of:
all, wlan(wifi), bluetooth, uwb(ultrawideband), wimax, wwan, gps, fm.usage: rm [-fiRrv] FILE...

Remove each argument from the filesystem.

-f	Force: remove without confirmation, no error if it doesn't exist
-i	Interactive: prompt for confirmation
-rR	Recursive: remove directory contents
-v	Verboseusage: rmdir [-p] [DIR...]

Remove one or more directories.

-p	Remove path
--ignore-fail-on-non-empty	Ignore failures caused by non-empty directoriesusage: rmmod [-wf] [MODULE]

Unload the module named MODULE from the Linux kernel.
-f	Force unload of a module
-w	Wait until the module is no longer usedusage: rtcwake [-aluv] [-d FILE] [-m MODE] [-s SECS] [-t UNIX]

Enter the given sleep state until the given time.

-a	RTC uses time specified in /etc/adjtime
-d FILE	Device to use (default /dev/rtc)
-l	RTC uses local time
-m	Mode (--list-modes to see those supported by your kernel):
	  standby  S1: default              mem     S3: suspend to RAM
	  disk     S4: suspend to disk      off     S5: power off
	  disable  Cancel current alarm     freeze  stop processes/processors
	  no       just set wakeup time     on      just poll RTC for alarm
	  show     just show current alarm
-s SECS	Wake SECS seconds from now
-t UNIX	Wake UNIX seconds from epoch
-u	RTC uses UTC
-v	Verboseusage: runcon CONTEXT COMMAND [ARGS...]

Run a command in a specified security context.usage: sed [-inrszE] [-e SCRIPT]...|SCRIPT [-f SCRIPT_FILE]... [FILE...]

Stream editor. Apply editing SCRIPTs to lines of input.

-e	Add SCRIPT to list
-f	Add contents of SCRIPT_FILE to list
-i	Edit each file in place (-iEXT keeps backup file with extension EXT)
-n	No default output (use the p command to output matched lines)
-r	Use extended regular expression syntax
-E	POSIX alias for -r
-s	Treat input files separately (implied by -i)
-z	Use \0 rather than \n as input line separator

A SCRIPT is one or more COMMANDs separated by newlines or semicolons.
All -e SCRIPTs are combined as if separated by newlines, followed by all -f
SCRIPT_FILEs. If no -e or -f then first argument is the SCRIPT.

COMMANDs apply to every line unless prefixed with an ADDRESS of the form:

  [ADDRESS[,ADDRESS]][!]COMMAND

ADDRESS is a line number (starting at 1), a /REGULAR EXPRESSION/, or $ for
last line (-s or -i makes it last line of each file). One address matches one
line, ADDRESS,ADDRESS matches from first to second inclusive. Two regexes can
match multiple ranges. ADDRESS,+N ends N lines later. ! inverts the match.

REGULAR EXPRESSIONS start and end with the same character (anything but
backslash or newline). To use the delimiter in the regex escape it with a
backslash, and printf escapes (\abcefnrtv and octal, hex, and unicode) work.
An empty regex repeats the previous one. ADDRESS regexes require any
first delimiter except / to be \escaped to distinguish it from COMMANDs.

Sed reads each line of input, processes it, and writes it out or discards it
before reading the next. Sed can remember one additional line in a separate
buffer (the h, H, g, G, and x commands), and can read the next line of input
early (the n and N commands), but otherwise operates on individual lines.

Each COMMAND starts with a single character. Commands with no arguments are:

  !  Run this command when the ADDRESS _didn't_ match.
  {  Start new command block, continuing until a corresponding "}".
     Command blocks nest and can have ADDRESSes applying to the whole block.
  }  End command block (this COMMAND cannot have an address)
  d  Delete this line and move on to the next one
     (ignores remaining COMMANDs)
  D  Delete one line of input and restart command SCRIPT (same as "d"
     unless you've glued lines together with "N" or similar)
  g  Get remembered line (overwriting current line)
  G  Get remembered line (appending to current line)
  h  Remember this line (overwriting remembered line)
  H  Remember this line (appending to remembered line, if any)
  l  Print line escaping \abfrtv (but not \n), octal escape other nonprintng
     chars, wrap lines to terminal width with \, append $ to end of line.
  n  Print default output and read next line over current line (quit at EOF)
  N  Append \n and next line of input to this line. Quit at EOF without
     default output. Advances line counter for ADDRESS and "=".
  p  Print this line
  P  Print this line up to first newline (from "N")
  q  Quit (print default output, no more commands processed or lines read)
  x  Exchange this line with remembered line (overwrite in both directions)
  =  Print the current line number (plus newline)
  #  Comment, ignores rest of this line of SCRIPT (until newline)

Commands that take an argument:

  : LABEL    Target for jump commands
  a TEXT     Append text to output before reading next line
  b LABEL    Branch, jumps to :LABEL (with no LABEL to end of SCRIPT)
  c TEXT     Delete matching ADDRESS range and output TEXT instead
  i TEXT     Insert text (output immediately)
  r FILE     Append contents of FILE to output before reading next line.
  s/S/R/F    Search for regex S replace match with R using flags F. Delimiter
             is anything but \n or \, escape with \ to use in S or R. Printf
             escapes work. Unescaped & in R becomes full matched text, \1
             through \9 = parenthetical subexpression from S. \ at end of
             line appends next line of SCRIPT. The flags in F are:
             [0-9]    A number N, substitute only Nth match
             g        Global, substitute all matches
             i/I      Ignore case when matching
             p        Print resulting line when match found and replaced
             w [file] Write (append) line to file when match replaced
  t LABEL    Test, jump if s/// command matched this line since last test
  T LABEL    Test false, jump to :LABEL only if no s/// found a match
  w FILE     Write (append) line to file
  y/old/new/ Change each character in 'old' to corresponding character
             in 'new' (with standard backslash escapes, delimiter can be
             any repeated character except \ or \n)

The TEXT arguments (to a c i) may end with an unescaped "\" to append
the next line (leading whitespace is not skipped), and treat ";" as a
literal character (use "\;" instead).usage: sendevent DEVICE TYPE CODE VALUE

Sends a Linux input event.usage: seq [-w|-f fmt_str] [-s sep_str] [first] [increment] last

Count from first to last, by increment. Omitted arguments default
to 1. Two arguments are used as first and last. Arguments can be
negative or floating point.

-f	Use fmt_str as a printf-style floating point format string
-s	Use sep_str as separator, default is a newline character
-w	Pad to equal width with leading zeroesusage: setenforce [enforcing|permissive|1|0]

Sets whether SELinux is enforcing (1) or permissive (0).usage: setfattr [-h] [-x|-n NAME] [-v VALUE] FILE...

Write POSIX extended attributes.

-h	Do not dereference symlink
-n	Set given attribute
-x	Remove given attribute
-v	Set value for attribute -n (default is empty)usage: setsid [-cdw] command [args...]

Run process in a new session.

-d	Detach from tty
-c	Control tty (become foreground process & receive keyboard signals)
-w	Wait for child (and exit with its status)usage: sha?sum [-bcs] [FILE]...

Calculate sha hash for each input file, reading from stdin if none. Output
one hash (40 hex digits for sha1, 56 for sha224, 64 for sha256, 96 for sha384,
and 128 for sha512) for each input file, followed by filename.

-b	Brief (hash only, no filename)
-c	Check each line of each FILE is the same hash+filename we'd output
-s	No output, exit status 0 if all hashes match, 1 otherwisesha1sumsha1sumsha1sumsha1sumusage: sleep DURATION

Wait before exiting.

DURATION can be a decimal fraction. An optional suffix can be "m"
(minutes), "h" (hours), "d" (days), or "s" (seconds, the default).usage: sort [-Mbcdfginrsuz] [FILE...] [-k#[,#[x]] [-t X]] [-o FILE]

Sort all lines of text from input files (or stdin) to stdout.
-M	Month sort (jan, feb, etc)
-V	Version numbers (name-1.234-rc6.5b.tgz)
-b	Ignore leading blanks (or trailing blanks in second part of key)
-c	Check whether input is sorted
-d	Dictionary order (use alphanumeric and whitespace chars only)
-f	Force uppercase (case insensitive sort)
-g	General numeric sort (double precision with nan and inf)
-i	Ignore nonprinting characters
-k	Sort by "key" (see below)
-n	Numeric order (instead of alphabetical)
-o	Output to FILE instead of stdout
-r	Reverse
-s	Skip fallback sort (only sort with keys)
-t	Use a key separator other than whitespace
-u	Unique lines only
-x	Hexadecimal numerical sort
-z	Zero (null) terminated lines

Sorting by key looks at a subset of the words on each line. -k2 uses the
second word to the end of the line, -k2,2 looks at only the second word,
-k2,4 looks from the start of the second to the end of the fourth word.
-k2.4,5 starts from the fourth character of the second word, to the end
of the fifth word. Specifying multiple keys uses the later keys as tie
breakers, in order. A type specifier appended to a sort key (such as -2,2n)
applies only to sorting that key.usage: split [-a SUFFIX_LEN] [-b BYTES] [-l LINES] [INPUT [OUTPUT]]

Copy INPUT (or stdin) data to a series of OUTPUT (or "x") files with
alphabetically increasing suffix (aa, ab, ac... az, ba, bb...).

-a	Suffix length (default 2)
-b	BYTES/file (10, 10k, 10m, 10g...)
-l	LINES/file (default 1000)usage: stat [-tfL] [-c FORMAT] FILE...

Display status of files or filesystems.

-c	Output specified FORMAT string instead of default
-f	Display filesystem status instead of file status
-L	Follow symlinks
-t	terse (-c "%n %s %b %f %u %g %D %i %h %t %T %X %Y %Z %o")
	      (with -f = -c "%n %i %l %t %s %S %b %f %a %c %d")

The valid format escape sequences for files:
%a  Access bits (octal) |%A  Access bits (flags)|%b  Size/512
%B  Bytes per %b (512)  |%C  Security context   |%d  Device ID (dec)
%D  Device ID (hex)     |%f  All mode bits (hex)|%F  File type
%g  Group ID            |%G  Group name         |%h  Hard links
%i  Inode               |%m  Mount point        |%n  Filename
%N  Long filename       |%o  I/O block size     |%s  Size (bytes)
%t  Devtype major (hex) |%T  Devtype minor (hex)|%u  User ID
%U  User name           |%x  Access time        |%X  Access unix time
%y  Modification time   |%Y  Mod unix time      |%z  Creation time
%Z  Creation unix time

The valid format escape sequences for filesystems:
%a  Available blocks    |%b  Total blocks       |%c  Total inodes
%d  Free inodes         |%f  Free blocks        |%i  File system ID
%l  Max filename length |%n  File name          |%s  Best transfer size
%S  Actual block size   |%t  FS type (hex)      |%T  FS type (driver name)usage: strings [-fo] [-t oxd] [-n LEN] [FILE...]

Display printable strings in a binary file

-f	Show filename
-n	At least LEN characters form a string (default 4)
-o	Show offset (ala -t d)
-t	Show offset type (o=octal, d=decimal, x=hexadecimal)usage: stty [-ag] [-F device] SETTING...

Get/set terminal configuration.

-F	Open device instead of stdin
-a	Show all current settings (default differences from "sane")
-g	Show all current settings usable as input to stty

Special characters (syntax ^c or undef): intr quit erase kill eof eol eol2
swtch start stop susp rprnt werase lnext discard

Control/input/output/local settings as shown by -a, '-' prefix to disable

Combo settings: cooked/raw, evenp/oddp/parity, nl, ek, sane

N	set input and output speed (ispeed N or ospeed N for just one)
cols N	set number of columns
rows N	set number of rows
line N	set line discipline
min N	set minimum chars per read
time N	set read timeout
speed	show speed only
size	show size onlyusage: swapoff swapregion

Disable swapping on a given swapregion.usage: swapon [-d] [-p priority] filename

Enable swapping on a given device/file.

-d	Discard freed SSD pages
-p	Priority (highest priority areas allocated first)usage: sync

Write pending cached data to disk (synchronize), blocking until done.usage: sysctl [-aAeNnqw] [-p [FILE] | KEY[=VALUE]...]

Read/write system control data (under /proc/sys).

-a,A	Show all values
-e	Don't warn about unknown keys
-N	Don't print key values
-n	Don't print key names
-p	Read values from FILE (default /etc/sysctl.conf)
-q	Don't show value after write
-w	Only write values (object to reading)usage: tac [FILE...]

Output lines in reverse order.usage: tail [-n|c NUMBER] [-f] [FILE...]

Copy last lines from files to stdout. If no files listed, copy from
stdin. Filename "-" is a synonym for stdin.

-n	Output the last NUMBER lines (default 10), +X counts from start
-c	Output the last NUMBER bytes, +NUMBER counts from start
-f	Follow FILE(s), waiting for more data to be appendedusage: tar [-cxt] [-fvohmjkOS] [-XTCf NAME] [FILE...]

Create, extract, or list files in a .tar (or compressed t?z) file.

Options:
c  Create                x  Extract               t  Test (list)
f  tar FILE (default -)  C  Change to DIR first   v  Verbose display
o  Ignore owner          h  Follow symlinks       m  Ignore mtime
J  xz compression        j  bzip2 compression     z  gzip compression
O  Extract to stdout     X  exclude names in FILE T  include names in FILE

--exclude        FILENAME to exclude    --full-time   Show seconds with -tv
--mode MODE      Adjust modes           --mtime TIME  Override timestamps
--owner NAME     Set file owner to NAME --group NAME  Set file group to NAME
--sparse         Record sparse files
--restrict       All archive contents must extract under one subdirectory
--numeric-owner  Save/use/display uid and gid, not user/group name
--no-recursion   Don't store directory contents
-I PROG          Filter through PROG to compress or PROG -d to decompressusage: taskset [-ap] [mask] [PID | cmd [args...]]

Launch a new task which may only run on certain processors, or change
the processor affinity of an existing PID.

Mask is a hex string where each bit represents a processor the process
is allowed to run on. PID without a mask displays existing affinity.

-p	Set/get the affinity of given PID instead of a new command
-a	Set/get the affinity of all threads of the PIDusage: tee [-ai] [FILE...]

Copy stdin to each listed file, and also to stdout.
Filename "-" is a synonym for stdout.

-a	Append to files
-i	Ignore SIGINTusage: test [-bcdefghLPrSsuwx PATH] [-nz STRING] [-t FD] [X ?? Y]

Return true or false by performing tests. (With no arguments return false.)

--- Tests with a single argument (after the option):
PATH is/has:
  -b  block device   -f  regular file   -p  fifo           -u  setuid bit
  -c  char device    -g  setgid         -r  read bit       -w  write bit
  -d  directory      -h  symlink        -S  socket         -x  execute bit
  -e  exists         -L  symlink        -s  nonzero size   -k  sticky bit
STRING is:
  -n  nonzero size   -z  zero size      (STRING by itself implies -n)
FD (integer file descriptor) is:
  -t  a TTY

--- Tests with one argument on each side of an operator:
Two strings:
  =  are identical   !=  differ

Two integers:
  -eq  equal         -gt  first > second    -lt  first < second
  -ne  not equal     -ge  first >= second   -le  first <= second

--- Modify or combine tests:
  ! EXPR     not (swap true/false)   EXPR -a EXPR    and (are both true)
  ( EXPR )   evaluate this first     EXPR -o EXPR    or (is either true)usage: time [-pv] COMMAND...

Run command line and report real, user, and system time elapsed in seconds.
(real = clock on the wall, user = cpu used by command's code,
system = cpu used by OS on behalf of command.)

-p	POSIX format output (default)
-v	Verboseusage: timeout [-k DURATION] [-s SIGNAL] DURATION COMMAND...

Run command line as a child process, sending child a signal if the
command doesn't exit soon enough.

DURATION can be a decimal fraction. An optional suffix can be "m"
(minutes), "h" (hours), "d" (days), or "s" (seconds, the default).

-s	Send specified signal (default TERM)
-k	Send KILL signal if child still running this long after first signal
-v	Verbose
--foreground       Don't create new process group
--preserve-status  Exit with the child's exit statususage: top [-Hbq] [-k FIELD,] [-o FIELD,] [-s SORT] [-n NUMBER] [-m LINES] [-d SECONDS] [-p PID,] [-u USER,]

Show process activity in real time.

-H	Show threads
-k	Fallback sort FIELDS (default -S,-%CPU,-ETIME,-PID)
-o	Show FIELDS (def PID,USER,PR,NI,VIRT,RES,SHR,S,%CPU,%MEM,TIME+,CMDLINE)
-O	Add FIELDS (replacing PR,NI,VIRT,RES,SHR,S from default)
-s	Sort by field number (1-X, default 9)
-b	Batch mode (no tty)
-d	Delay SECONDS between each cycle (default 3)
-m	Maximum number of tasks to show
-n	Exit after NUMBER iterations
-p	Show these PIDs
-u	Show these USERs
-q	Quiet (no header lines)

Cursor LEFT/RIGHT to change sort, UP/DOWN move list, space to force
update, R to reverse sort, Q to exit.usage: touch [-amch] [-d DATE] [-t TIME] [-r FILE] FILE...

Update the access and modification times of each FILE to the current time.

-a	Change access time
-m	Change modification time
-c	Don't create file
-h	Change symlink
-d	Set time to DATE (in YYYY-MM-DDThh:mm:SS[.frac][tz] format)
-t	Set time to TIME (in [[CC]YY]MMDDhhmm[.ss][frac] format)
-r	Set time same as reference FILEusage: tr [-cds] SET1 [SET2]

Translate, squeeze, or delete characters from stdin, writing to stdout

-c/-C  Take complement of SET1
-d     Delete input characters coded SET1
-s     Squeeze multiple output characters of SET2 into one characterusage: traceroute [-46FUIldnvr] [-f 1ST_TTL] [-m MAXTTL] [-p PORT] [-q PROBES]
[-s SRC_IP] [-t TOS] [-w WAIT_SEC] [-g GATEWAY] [-i IFACE] [-z PAUSE_MSEC] HOST [BYTES]

traceroute6 [-dnrv] [-m MAXTTL] [-p PORT] [-q PROBES][-s SRC_IP] [-t TOS] [-w WAIT_SEC]
  [-i IFACE] HOST [BYTES]

Trace the route to HOST

-4,-6 Force IP or IPv6 name resolution
-F    Set the don't fragment bit (supports IPV4 only)
-U    Use UDP datagrams instead of ICMP ECHO (supports IPV4 only)
-I    Use ICMP ECHO instead of UDP datagrams (supports IPV4 only)
-l    Display the TTL value of the returned packet (supports IPV4 only)
-d    Set SO_DEBUG options to socket
-n    Print numeric addresses
-v    verbose
-r    Bypass routing tables, send directly to HOST
-m    Max time-to-live (max number of hops)(RANGE 1 to 255)
-p    Base UDP port number used in probes(default 33434)(RANGE 1 to 65535)
-q    Number of probes per TTL (default 3)(RANGE 1 to 255)
-s    IP address to use as the source address
-t    Type-of-service in probe packets (default 0)(RANGE 0 to 255)
-w    Time in seconds to wait for a response (default 3)(RANGE 0 to 86400)
-g    Loose source route gateway (8 max) (supports IPV4 only)
-z    Pause Time in ms (default 0)(RANGE 0 to 86400) (supports IPV4 only)
-f    Start from the 1ST_TTL hop (instead from 1)(RANGE 1 to 255) (supports IPV4 only)
-i    Specify a network interface to operate withtracerouteusage: true

Return zero.usage: truncate [-c] -s SIZE file...

Set length of file(s), extending sparsely if necessary.

-c	Don't create file if it doesn't exist
-s	New size (with optional prefix and suffix)

SIZE prefix: + add, - subtract, < shrink to, > expand to,
             / multiple rounding down, % multiple rounding up
SIZE suffix: k=1024, m=1024^2, g=1024^3, t=1024^4, p=1024^5, e=1024^6usage: tty [-s]

Show filename of terminal connected to stdin.

Prints "not a tty" and exits with nonzero status if no terminal
is connected to stdin.

-s	Silent, exit code onlyusage: tunctl [-dtT] [-u USER] NAME

Create and delete tun/tap virtual ethernet devices.

-T	Use tap (ethernet frames) instead of tun (ip packets)
-d	Delete tun/tap device
-t	Create tun/tap device
-u	Set owner (user who can read/write device without root access)usage: ulimit [-P PID] [-SHRacdefilmnpqrstuv] [LIMIT]

Print or set resource limits for process number PID. If no LIMIT specified
(or read-only -ap selected) display current value (sizes in bytes).
Default is ulimit -P $PPID -Sf" (show soft filesize of your shell).

-P  PID to affect (default $PPID)  -a  Show all limits
-S  Set/show soft limit            -H  Set/show hard (maximum) limit

-c  Core file size (blocks)        -d  Process data segment (KiB)
-e  Max scheduling priority        -f  File size (KiB)
-i  Pending signal count           -l  Locked memory (KiB)
-m  Resident Set Size (KiB)        -n  Number of open files
-p  Pipe buffer (512 bytes)        -q  POSIX message queues
-r  Max realtime priority          -R  Realtime latency (us)
-s  Stack size (KiB)               -t  Total CPU time (s)
-u  Maximum processes (this UID)   -v  Virtual memory size (KiB)usage: umount [-a [-t TYPE[,TYPE...]]] [-vrfD] [DIR...]

Unmount the listed filesystems.

-a	Unmount all mounts in /proc/mounts instead of command line list
-D	Don't free loopback device(s)
-f	Force unmount
-l	Lazy unmount (detach from filesystem now, close when last user does)
-n	Don't use /proc/mounts
-r	Remount read only if unmounting fails
-t	Restrict "all" to mounts of TYPE (or use "noTYPE" to skip)
-v	Verboseusage: uname [-asnrvm]

Print system information.

-s	System name
-n	Network (domain) name
-r	Kernel Release number
-v	Kernel Version
-m	Machine (hardware) name
-a	All of the aboveusage: uniq [-cduiz] [-w MAXCHARS] [-f FIELDS] [-s CHAR] [INFILE [OUTFILE]]

Report or filter out repeated lines in a file

-c	Show counts before each line
-d	Show only lines that are repeated
-u	Show only lines that are unique
-i	Ignore case when comparing lines
-z	Lines end with \0 not \n
-w	Compare maximum X chars per line
-f	Ignore first X fields
-s	Ignore first X charsusage: unix2dos [FILE...]

Convert newline format from unix "\n" to dos "\r\n".
If no files listed copy from stdin, "-" is a synonym for stdin.usage: unlink FILE

Delete one file.usage: unshare [-imnpuUr] COMMAND...

Create new container namespace(s) for this process and its children, so
some attribute is not shared with the parent process.

-f	Fork command in the background (--fork)
-i	SysV IPC (message queues, semaphores, shared memory) (--ipc)
-m	Mount/unmount tree (--mount)
-n	Network address, sockets, routing, iptables (--net)
-p	Process IDs and init (--pid)
-r	Become root (map current euid/egid to 0/0, implies -U) (--map-root-user)
-u	Host and domain names (--uts)
-U	UIDs, GIDs, capabilities (--user)

A namespace allows a set of processes to have a different view of the
system than other sets of processes.usage: uptime [-ps]

Tell the current time, how long the system has been running, the number
of users, and the system load averages for the past 1, 5 and 15 minutes.

-p	Pretty (human readable) uptime
-s	Since when has the system been up?usage: usleep MICROSECONDS

Pause for MICROSECONDS microseconds.usage: uudecode [-o OUTFILE] [INFILE]

Decode file from stdin (or INFILE).

-o	Write to OUTFILE instead of filename in headerusage: uuencode [-m] [INFILE] ENCODE_FILENAME

Uuencode stdin (or INFILE) to stdout, with ENCODE_FILENAME in the output.

-m	Base64usage: uuidgen

Create and print a new RFC4122 random UUID.usage: vconfig COMMAND [OPTIONS]

Create and remove virtual ethernet devices

add             [interface-name] [vlan_id]
rem             [vlan-name]
set_flag        [interface-name] [flag-num]       [0 | 1]
set_egress_map  [vlan-name]      [skb_priority]   [vlan_qos]
set_ingress_map [vlan-name]      [skb_priority]   [vlan_qos]
set_name_type   [name-type]usage: vi [-s script] FILE
-s script: run script file
Visual text editor. Predates the existence of standardized cursor keys,
so the controls are weird and historical.usage: vmstat [-n] [DELAY [COUNT]]

Print virtual memory statistics, repeating each DELAY seconds, COUNT times.
(With no DELAY, prints one line. With no COUNT, repeats until killed.)

Show processes running and blocked, kilobytes swapped, free, buffered, and
cached, kilobytes swapped in and out per second, file disk blocks input and
output per second, interrupts and context switches per second, percent
of CPU time spent running user code, system code, idle, and awaiting I/O.
First line is since system started, later lines are since last line.

-n	Display the header only onceusage: watch [-teb] [-n SEC] PROG ARGS

Run PROG every -n seconds, showing output. Hit q to quit.

-n	Loop period in seconds (default 2)
-t	Don't print header
-e	Exit on error
-b	Beep on command error
-x	Exec command directly (vs "sh -c")usage: wc -lwcm [FILE...]

Count lines, words, and characters in input.

-l	Show lines
-w	Show words
-c	Show bytes
-m	Show characters

By default outputs lines, words, bytes, and filename for each
argument (or from stdin if none). Displays only either bytes
or characters.usage: which [-a] filename ...

Search $PATH for executable files matching filename(s).

-a	Show all matcheslognameusage: xargs [-0prt] [-snE STR] COMMAND...

Run command line one or more times, appending arguments from stdin.

If COMMAND exits with 255, don't launch another even if arguments remain.

-0	Each argument is NULL terminated, no whitespace or quote processing
-E	Stop at line matching string
-n	Max number of arguments per command
-o	Open tty for COMMAND's stdin (default /dev/null)
-p	Prompt for y/n from tty before running each command
-P	Parallel processes (default 1)
-r	Don't run with empty input (otherwise always run command once)
-s	Size in bytes per command line
-t	Trace, print command line to stderrusage: xxd [-c n] [-g n] [-i] [-l n] [-o n] [-p] [-r] [-s n] [file]

Hexdump a file to stdout.  If no file is listed, copy from stdin.
Filename "-" is a synonym for stdin.

-c n	Show n bytes per line (default 16)
-g n	Group bytes by adding a ' ' every n bytes (default 2)
-i	Include file output format (comma-separated hex byte literals)
-l n	Limit of n bytes before stopping (default is no limit)
-o n	Add n to display offset
-p	Plain hexdump (30 bytes/line, no grouping)
-r	Reverse operation: turn a hexdump into a binary file
-s n	Skip to offset nusage: yes [args...]

Repeatedly output line until killed. If no args, output 'y'.usage: zcat [FILE...]

Decompress files to stdout. Like `gzip -dc`.

-f	Force: allow read from tty .A34567
PP0 @	2Kn,X`	%K @B`%&-g5	=%"


5

*





2::::::::::::::}::::::p::m:::::::sz::v-character devicedirectoryblock deviceregular filesymbolic linksocketFIFO (named pipe)N'}v804-<R)5]1@G` @XHh|7
yyyyyynPXDh` _Wt[

		

 _abcr`rq@ph^]].... ` @userutspidnetmntipcrbswpdfreebuffcachesisobiboincsussyidwa
"!!!!!!AVq2Kn,X`	%K @B`%&-g5	=#+/37'pvN|T7>Y
EKEEOS;Lh\8,`l0(`$HLphȧ`8`4T(Ppİ\ر8Բ`d|Dܶ(ԷP<xй4x0<P|pL P( X  D  0 H! !8!P!!!!!"8"TX"pp""h"""8#D(#P#p####$$($,P$$P$$$(%x %H%h%%%%& &H&Lp&\&&&&'@'pp'<''P'(((@(0`(x(((,(l() )8)`)),)) )\*h0*P*p*l**$*|+(+$P+Lx++8++<,0,H,$`,D,,,,-(-@-X-Tx----$.8.X.....\/( /P@/h/`///</l000P0p0<0001t 1@1`141T111	2P	 2	@2Th22 22238
03d
P3
p3
3\333d 4H4$h404\44450 5d@5`5p555$56@6 h6\66@66787,h777778x(8`"X8"x8 %80&8'8( 9(@9h)`9)x9x-9-9-9h.9/ :0@:D3p:4:4:5:`8;<@;<h;4=;=;@;X@;t@<B8< BP<Bx<B<C<K<L=M0=TNX=HO=P=TQ=T>dU0>0W`>W>^>X_>x_?T`0?a`?ax?hc?d?Hj?j@l8@,lP@lp@t@t@w@,x AyPAA`AA AXB\8BpBB0BBtCHHCpC CCCD\ D4XDȜDlD8D4EX EHEحpEELE EHF8F@hFFlFFG|8G`GGGGH(HHXHPH4H|HTH(IHIdxI$III0 JPJpJhJJJK KHKK8	KKL(LPLhLL8LLLM M8M``MM` Mx!M"M$N%@N(pN@+N+NP,N/O9@OD:`O:O:Oh;O?O@PB8PChPFP$GPHP4TQU@QdxQfQXgQDhRh(RlXRLlpRxpRqRtR@v SlzPS${pS{S{SĎSdT0T0XTțTTМT0TUl@UȟXUUĢUUxVl@VtXV|VtV\VVpWHWزxWWظW̺WX8XhXXTXX(YPHYpYxYYZ ZHZxZHZZZZ [H[p[[[[[h\0\H\Xp\`\t\$\l]0 ]@](h]]]p]P^ 8^th^^^
^_t
8_<h_|___l`8```x```&a& a(Ha80a44a5a5a6b=Hb?xbCbFbFbDN(cNPcRcRcSc\TcXV dxWHd,YpdYdZd<\d\e]8e _heDdede4eefff8fg`fDhfjfjflgLm0gmXgmpgTpg rgrgXshs@h0thhXththwhwhTxi{8i(~hiliLiiHi(jPjXj؆jjk40kPktkkkk@lL@l(`llxl@llԞ m8mhmmmPmn0nXnnn<n4oح o@o(hopoooܵp0p@Pp\hppp,pܻq(q`qDqqqq<r48r(hrdrrPrs sHshss<sss thPtt(ttDt40uXu`uuuuPv8@vhvhv`vvw((w`XwwLw|wtx0x`xxxx	y	(yX
HyxyyTy!y$(z$Hz8)xz.z/zX:{: {L;H{;p{<<{<{T={8>|8@0|AX|B|4C|PD|E|LV(}WP}Wx}dX}Y}tY}Y~pZ8~ZX~$[~[~[~(\~]]8^`L__abhc(cH(dhddDeЀDffh@h`$ihiill`~H8p|DȂ 8PpЄ0LP܉<؄̌` @hdhȔ@\`ؗ@|h̢0`d؈0(\P<xhȉHh|48hzR|DxDD-L,<hxdD-``
,lD-X@$D-X@$D-P0
$TD-P0
,Ą@D-\P
$DԅD-T0
,lpD-X@
88X@,D-\P
$ԉ(D-T@$Ԋ$<؊XD-T@
$dD-P0
8D-L Ȍ8D-L `D-L $ D-P0
,D-\`
DTHD-L ,d|TD-\P
$$D-X@
D-P $$D-T0
xD-P $D-P DD-P d|D-H$|D-P0
$D|D-P0
$D-T@,lD-``
D̖,\̖D-XP
,dD-``
̘D-P $\HD-P0
$|hD-P0
$,D-T0
T(dD-L tlDD-L DD-L,DD-\P
ȝ<D-L @D-L $DD-H,D(D-\P
$tdD-P0
<$dD-P0
, XD-\P
,H4D-XP
$<LhD-P0
ddD-P ТD-P 88Dd4,	D-XP
4	X$L	TD-T@$t	D-T0
$	hD-P0
$	إD-X@	pD-L 
$
XD-L $D
0D-P0
l
l
H
,$
0D-T0
$
|D-T0
h$D-H$$lD-T0
,L0D-``
|4D-L $D-P0
$<D-P0
,ԯD-``
,4\lD-\`
dD-P ,( PD-L $PD-T@
D-L ,
<D-\P
,L
D-\P
|
LL-L 

pD-P $
d`D-P0
$
`D-P0
$$ԷD-X@LD-P $lD-P0
4D-P $xtD-L ,ĺdD-``
$$D-T0
LD-P $l,dD-P0
hhD-P $@D-X@
Ⱦ0D-L $ȾHD-P0
<TLlPT@|lD-L ȿ п $ؿD-T@$4`D-P0
<l0D-H$\|D-T0
<,0<D-\P
<0,D-H<,D-H$$HD-T@,LlD-``
|LD-L 4XD-L l,D-H$x|D-P0
$(D-X@
,,D-\P
\(`tplD-L $D-P0
$,D-T0
 D-H$4`D-P0
$\XD-X@$D-L D-P lD-H,0D-H,LD-\`
$|D-P0
$D-T0
`D-L D\D-H$4D-X@,4D-``
d||D-P TD-P (D-L $D-P0
$hD-P0
D,D-HdPD-L `D-HD0D-HT<D-L p<D-L ,D-H$,D-HDDD-L $dLD-P0
$D-X@D-P LTD-L <D-L 0D-L 4 D-HTDD-Ht$pD-P0
<D-H(dD-L $lD-X@
D-P <P@D-L $\pD-T0
0D-L $D-H<D-L ,D-H4D-H$ 8D-H$D8D-P0
lDD-L XD-L $lD-P0
$<pD-P0
PD-L 4,D-HT<D-L t0D-H<D-L ,D-H4D-H<D-L ,8D-``
D<D-L d<D-L <D-L $,D-T0
$D-T0
$DD-P0
<D-L $<pD-P0
dtD-L $hD-T@$D-T0
,LD-\P
dD-P $<D-P0
dX|D-L \D-L D-L ,HD-``
 D-L ,, `@D-``
$\ pD-X@
$ XD-P0
$ D-P0
 \`D-H D-P !`,,!HD-``
\!t!!D-P $!hhD-P0
!D-P ,!8D-``
,$"D-``
T"Hl"8D-P ,"D-X@4"PD-dP
HIJK$"dD-P0
#D-P <#D-L$\#DD-T0
#4LD-L #`,#dD-XP
#$$D-T@,$H$D$HD-L ,l$D-``
$$\D-T0
$D-L $$|D-P0
$%D-P0
,4%lD-X@
d%D-H,%|D-``
,%LD-``
,%,D-``
$&|D-P0
,<&D-``
,l&D-XP
&h  D-H$&h D-P0
,&!HD-\@
H'4"(,,'D"D-XP
\'#D-P ,|'H$0D-``
'H*d$'*pD-X@
'+(+D-L ,$(8,dD-``
$T(l3D-P0
,|(3D-``
$(6D-T0
,(7D-``
,)8D-``
$4)d?tD-P0
\)@4t)@D-P ,)8A8D-\P
$)@ED-T0
4)FD-``
,$*GD-``
T*ID-L $t*hJD-L $*JD-T@
4*\MD-\`
$*QD-P0
$+R,<+RD-``
l+T\D-L $+TD-``
,<>TD-\P
l>V$>WD-P0
>WtD-L ,>PXtD-``
,>ZD-XP
,,?X[D-``
\?`,$t?aD-X@
$?bD-T@$?gD-T0
,?h,D-``
,@kD-``
,L@@ntD-\P
,|@oD-XP
,@oD-\`
@qD-L $@rdD-T@,$AD-L V>D-P $VH?D-X@
$W@HD-L ,DW@D-``
$tW,CD-P ,WC0D-\`
WEWE\D-L XEXE<D-H$D-L 4|q$?D-``
q@,q@D-``
qBD-P $rTCD-T0
$DrD\D-L ,lrED-``
$rGD-P $rHLD-L ,r@HLD-\P
4s\KD-``
Ts4MtsM$?#{()*)AJBBA#a?#{o	g
_WO
Y;(@ZZAoH@	m@9I9	@x****R@9qlTqMTq`TqT@8kQqTq@TyqTC
qT?	);@8kQ;R5C@94=s/Z=@9?lq
TT
R@=<@9?qT@1@T@94q@TR@99ARj@
@55	1T@)R)!	**@9	1T@9*qTq@Tq(TBR] T7@h4]`T7]Ѹ@9h5@9@JJA+R@qAT
Q@9l!ɚ6K@*K@94%@
L@)@9(4Cs" a5R@9s	@9uq T*	|@*@9k@uqTq@Tm@kaT+"jTm
	
@,

J"H*uqT@95*H@* }[#	i` H#@@4H@@U@@W@9qaT?@(R(RH#@@kT@kTK@4I@?`T_9(@_	TOMWL_KgJoI{H#_(R6RC@q	TqT@9qT?@9qT	@8)4	@9?qAT

@9(	4@;ta@ 5hjt8q`T5Ah@@95{@;;@4#?@(4H@ASS@	@9I4@A*@_	kT*P@96
@9j4!@C"RV5@U@SC@zvx4CH#vJ@K#Iy(U@zvWCha@C*/_q(YjYi?q))"Yh@oѠ>*Q@9j6*@
8)@i	@99
J7?q A,
 7?#C{WOCV;@AHA+@

@
@Ti@*R+@
@@

@T)@J@

@J+@I		
*@k6@j
*j6R@9k6KRk2?
Tj@+R	T_TL@	ATJ@ki
@Ib4*@945
h*@4 R
R@97е7u
@94qT@*	@)	qi.@4i@)iyi@_1!Th@	@?T@	@0 !;~@9i5R@96Q-qT)+ih8J	@֟$wq!TIШ@9)A)@	@9rڂ@
T"@T@8ZqaT@($՗@@		Tg aT"@		Tg aT@08$? @
$Ո@@RT$h.@57h
*@@	TODWC@{AC#_ց@B@0a
@-/!;
@7	@@# N?#{WOW;@`@C3,@?@t@_	TOEWD@{B#_HA@@@
@)(KXRz?#{O@h@94Rx K@((@gOB@{è#_?#{O@t@9(4Q_8
)mJ7qBJuOB@{è#_?#{g_WOZ;H@*'C3@*~@@9qT@9q({S**@)K?kTC(4C3 6R34@9*H@_	AT*OFWE_DgC{B#_?#C{WOV;@4R!(@94C3VU**4@@954R@_	T*ODWC{BC#_ֱ?#{_WOX;@*|@C3!@kT`4w@96R*@_	!T*OEWD_C{B#_s_$@9qT@94qaT@9h4*_ R__$@HB9qTB94qaTB9h4`R_*_?#{	S_WO
CX;@o**@**7RGv R5
**P4TW5@	qT R*E486*9R,@
)@qTWAR*A7* 8u 7h@9qTh@94qaTh
@9H4QBP,**
}@P?qR	R"*({S94sv5RR9B4A!A7*
(R	!7@_	ATOMWL_KS@{I#_ִ
?#{WOa@*h@*
 4Q(B9q(K@T~@65R
4Q(8B9qK(}@
@
s}
5
OCWB@{Ĩ#__$@h)@_`_?#{_WO*_1(T_1TX
*

B06N@9Q)qTN*
`h@5@@5J@9MS@$@T 7s4
*@t
6B929?*p
**OCWB_A{Ĩ#_?#{O?*r ThB@
@qT(K84h@)@3Rb`RM
***h
@7rsOB@{è#_?#{*|@{¨#տ?#{*n@{¨#ձ?#{OHA	@(@H4!R@i3%hROA{¨#_?#{OSsAiB@I4TA@@H)T@@(iB@RHA(RhBOB@{è#_?#{g_WOXAWC@AH5@*
Cyi
(2}C@}ӚRfT
Y`@@**~@5ju8qATC@Q_kbTCF{4@Z	Yz	y9Y*@xyvT5Sr!TH}ӛ3RX3t@y9OEWD_CgB@{ƨ#_@@6h.
?#{R@{¨#w@<?#{_WOCV;@W*HA@AE7HA!T @@49Qy5@9qTNE4!,8%!@hhb84)q`TB!)@@	!TOEWD_C@{A#_֛?#{_WOV;@WXA*@A!	"@@4qT7@@R@9h5(R9@_	TOFWE_D{C#_֡@@@*@@!'@R?#{OC	
_S;k@#o)J>'=3>~C*=h@_	TOR{Q#_(?#{OC	
_T;Ջ@#o)J>'=3>.~@C=j@_	TOS@{Q#_
?#{89o)J?'>/?*:>B?#{O89:
@q@To)?'>I#?@>?#{89o:?HA!R@Jk#?/>>_$9e?#{9?#{WO"**
@4|@7TOBWA{è#_?#{WO"*b*
q|@TTOBWA{è#_?#{WO"R*
TBR*
TjTsUART@v2*7ks ˪T	**
TOCWB@{Ĩ#_|;1<.?#{	o
g_W
OCX;@**o**
`4[{A'Rjy8rq?)
*Z	*_qT5**7$hG@Rj98
!R*i
46	@Eq`T7j98Z79Ih@)A!$@ @*
6@
@qaT*	(R R@_	ATONWM_LgKoJ{I#_֤	_$`CR*?#{g_WO|`9?_8q@T5K?q+TV`&`h@!	h@!9s@_85ODWC_BgA{Ũ#_?#{
og_
WOI;(@`	#RAR`	`T	oL	4(8)@ v	`88l	9	() B()# #C	 5#@
!@qT?,	87'	@(@_	ATOOWN_MgLoK{J#_	?#{O89S;i@o	k>/='>~C*=	h@_	TOQ{P#_?#{O**OB@{è#p	?#{WO**a	@5OBWA{è#_9?#{WOCU;ը@*@ T@94	Q
2?iqA1BRz
KI	q@T_qAT	@9?qT*%Q_qT	@8?q*%QT_qcTT5@@	TOCWB{A#_֔w?qkT
@9J4KQL2iq1
_qAT))K)	
}R)1~
T)		)yS"ɚ$1RI?#{OT?LTOA{¨#_x<8?#{?rT!3`K@{¨#_?#{I;(@(9
47_q
9HqiT3**r(TLQR
*
*,4
@9OqATe3-*kySQ
*o4R˨]E(R#	,
_!J+
_
kTH}SAq(TKQ
R
kT*
()@_?
T{B*#_?#{_WOCX;@2%~@h@9(4dqMT*@a**aqT ?ksB6Th@88h@95B~@h@97h59@@	TOEWD_C@{A#_h#*}?#{O7yOA{¨#_?#{AR-@9H59@{¨#_?#{*d1(1T-`8*{#_?#{g_WOU;ը@	@ `(@9qq#)AT@94qT(	h(	@99?q	9>.qLT@R#`@?@T_Akyq9#Ti@(h@@9<1Ti@]
`8)iR@_?
ATOGWF_EgD{C*#_?#{OT@4OB@{è#__$)@9@4
@9_)kT)@8i5)@9?r_?#{WOt@|@`5hOBWAq{è#_?#{
g_W
OW;@oC*s5#@
!@qaT#@.#*$`4@("R*9R8RY**9:A	"R*XAT(6
	_T**@_	ATONWM_LgK{J#_S?#{_WOH@*h	*TR*+T@(A*T@`j(8`T!ODWC_B@{Ũ#_?#{O*]1@T**HOB@{è#_?#{CS;i@`h@@	T@{A#_?#{hjtS;|Hk@G	}R
HRHr		)}
##h@_	T@{B#_ֱ_$RZ__$4*J}@8,q})!_	k!̚`AT___$!4*@8)HxT__$բ4Bq8!HT_?#{_WO@**z :%9B 4**["!_jT@*?t6X4*@?28@ODWC_B@{Ũ#_֟rODWC_B@!8%{Ũ#_$R*?#{WOV@ s:%94**7CAR_@OCWB@{Ĩ#_OCWB@AR*{Ĩ#?#{WOCU;ը@*9"R*T@Tt@9?)qij68Tj(8ijh8?)qATj(8@@	TOCWB{A#_?#{O***@4(*(A)R	9*OB@{è#_?#C{	SWOCV;@*oWC*`0;R(A
J"	@	(@*v5@*C)*@_	!T*OLWKS@{IC#_ք?#{Oa04AR@L!@!A~OA{¨#__$HCKTj_?#{O**`@`]`@H)R	bOA{¨#_?#{WOH@**D18T****`@H)R	`@=;OBWA{è#__$鶃R
dR)r
rS?qk4m}SNKJrmyS.Jq1Tx(T__$(RmqTqTqT(RR8hRy__$(A*@?#{WOCV;5A@?q)R@*R*B
R	R#!9B@!R"Rе/@9q@T	%Q?qT	Q
2?iqA11s!R"R@@	T*OCWB{A#_֬?#{OCT;Ո@5*AN@4"R*94y@@	TOC@{A#_֍?#{4))A2(9
?#{WOCU;ը@	
R}@**}SV*p
*@
(h5@Rs
qT@R|@@	TOCWB{A#_Q?#C{og_WOH;@@9	Q?)q)L#T*<R>8*	r T*R@8	K#3*5s4**F*DR@9*.*1T@84R 
@9K#*4RѸ(7(6@q2T)	R	
55@91T&	
****
>8#2*

#jT?
qATqNK486#2jl4'Oqqq1
*qoZj

*k
qT)?q
T@9_q`T5@8vCRL@(5?qT_@95@*@*@@_	TOHWG_FgEoD{CC#_@X8_$kUR*)R*RKUr
?(9}aP!Kr
Tp4@in8	$qO6Io8qyR.h)8)T@Q}S-qT)!++ih8J	R@֟$R$hR$ըR	$HR$Ո
R$hR$(9_?#{R`@{¨#_?#{O!R@9)4K@9)kT	@8Ji5@94uj`8$qTOB@{è#_?#{WO@k@9K4*ijj8+kTl+ij8JqH5*$**	}@h(
@9_q`Tj54	<R~)6R)
ŅR	q)
h	9jyaT	POBWA{è#_?#C{og_WOH;@p7*7AL4*4RB@)*R#`
[H
jh8?)qTj(8@@@o-q(@S48T_T45*_T`4xBBP*MRc`F@k(8`44D
5!@*? 5 @`oRBl*#@5S@@	TW@@	Tgp@@^	TO\W[_ZgYoX{WC#_.+?#{g_WO*r}R	R**8HkTS*	ۚ=kTB<7u4q!T*#ȚRjI}	)(	Ț}ɛCB
6	Ri 8*u48u8
Q_iq 9@z	R(6HR	h 8	* 8OEWD_CgB@{ƨ#_?#C{O9:S;h@oJk>+=#>~/='>~CbR*=.h@_	TOQ{P#_ւ?#{Ox(*****H*OB@{è#_?#{CS;h@ h@@	T@{A#_O?#{_WOW;@?q**8TZC*7kTC@K(k–qTkT
B78(A#@*6kT
B7'@_kÔ	TOEWD_C{B#__$կ?#{@@{¨#?#{O@`?ֿaTOB@{è#__$@	@	__$@	@?@Ti
@*	@i
@*	@	__$@@	@?@Ti
@*	@i
@*	@I__$@h(@@(@@@!!_?#{ORh@hh@@h@@h@!`OA{¨#__$@@__$@`T@_?#{WO@@T@v|@Bh@TwOCWB@{Ĩ#_?#{O**`7AR"R**OB@{è#_**d?#{1T{#_
X?#{+OU;ը@)*o))#<<5@@_?
TOF+@{D#_֠5#7)8J=AX_$*?#{g_WOCV;@)R()A)A7A?qJ#k8t9#H@@@)B@(?!RBRR*V1TA@B@*?`4H@h4*Z@U@@	T*OEWD_CgB{A#_
_$!R?#{C5{#_#?#{>5{#_?#{WO**_qT7A**(6@yh5@21qTKsOCWB@{Ĩ#_֠?#{og_WOH;@***(R#AR**+yy#VR48AVRRqTH@y7 6<@_Rq
T|@*`[y@!RQ*6Z#T#**`5*@@_	aT*OGWF_EgDoC{B#_?#{	 D@x3sAR	q*@{¨#_?#{h@yR*	qR T@{¨#_D?#{7{#_"?#{O
)_q* A1 T**4* R*OB@{è#_?#{_WOX;@AABR*C3"@ubBT45haD9h5@	~ 4C3  R4R*q@_	TOEWD_C{B#_j?#{_WOCY;(@).5!T# 	&@T@P
@L@Hq@B@B
@b@@@Y@@@(@@	TOEWD_C@{A#_֠h7.	@9?qqTI4	9
*+Rhk8Q%qTk
!T
99_?#{O*RV`7~}@zS`}~<`
OA{¨#_/='>~ =AC*>h@_	TOQ{P#_֒_$|S-3*__$LS__$(|S,3-3*_?#{@
ii
aT
	@@)A?!TB  A{#_?#{ANRr} *}S{#_?#{g_WO**C7n99ARh@h@bR*T@*ATW@-qTTOEWD_CgB@{ƨ#_?#{OuUR4RUUrqT	})a)		K*-4*OB@{è#_$AR'OB@{è#ղ?#C{WOV;@**4CaR*4qT'@yH4#@yH48!3!#@tH4@sI4i@_(*q_TODWC{BC#_ִ?#{O 4t@4sh@h4 RH/*OA{¨#_?#{)Q+*yh_kTyaT)=q)R)({#չ?#{#WOW;@*o**#5#@@"(A	(R
(RR@lGR@rH/)u44)Q+*yh_kTyaT)*W=q)R)(|AR*@_	TOFWE#@{C#_8?#{og_	W
OH;@ѩB@8*"2RBr(Ҩ`Th
@C3>j(8@!:sC_5h@9*jjJk)_aaT
@
Tn
@9im8kTkTJ_Tih8I4J_)R!Ti41aTrTrR!RI4(AyqlTh@9"R*!Th@9{9H}@|jh9@@_	aT*OKWJ_IgHoG{F#_(A@y=qHZ'A9jC]Hi3@(Uh@9h4u@9Qrh9 Ta
@5_$T_$Ո?#C{#S;h@o#B0=Roh@_	T#@{CC#_f?#C{OT;Ո@***s!m!ioB0=R}R$RA]!l<YK@_	TOD{CC#_3?#{*hqu?#{OA@yH5
R)R!R**i!AR@yR	kTySOB@/{è#?#{O(T%OB@{è#_t<?#{A@`@9(!R,?#{OA@H@*? R?#{45A@4A@94{#_֠h%{#Շ?#{T{#_֠;?#{@{¨#_֠7?#{O*OA{¨#_?#{{#_@?#{{#_v?#{n@{¨#_e?#{OOB@{è#_?#{WO	
_V;@#o)J=';3<}<<>}@~|>@_	!TOVWU@{S#_?#{OC	
_S;k@#o)J>'=3>~CѠ=h*%h@_	TOR{Q#_?#{O R*b~@ Ro3TOA{¨#_֠?#{`T@{¨#_֠?#{@{¨#?#{.*{#?#{A@(1T*{#h%_$E?#{O(x*
R*y*1!T	A)Aq(?*OB@{è#_?#{41T<A{#_?#{O@@AR	q(9a@ .@h@9w?#{_WOW;@)R#zh	*_1T 5*(R7V4@*4@@4@{H*4@_	T*OEWD_C{B#_֠|	:@4d@@4_@@`5@4**@R@qT!R@Kt?ssA`@.h@@??#{OCT;Ո@***1T@qT@@@=Sr2`?
TOB{A#_?#{O* @@*OA{¨#?#{WOCT;Չ@_qZZ#)R~@h@@	TOCWB{A#_֓?#{***@{¨#ՠ?#{2{#՗?#{5@{¨#_h?#{5{#_d=?#{1`T5{#_(9}?#{1T1T{#_֠o?#{O*qTs(***ARr*%1aTq*T**OB@{è#_?#{O5OA{¨#_;?#{B0;`1T@{¨#_0*?#{O(x*
R*1!T	A)Aq(?*OB@{è#՜?#{O(x*
R**1!T	A)Aq(?*OB@{è#Հ?#{O*!8%4ROA{¨#OA{¨#__$R?#{e{#_/?#{^@{¨#_֠7?#{{#_֠/?#{T@{¨#_?#{{#__@9qAT!pc'@hi8qT'@(}@)RJ	
JyS@9kQ%qTj
')?)qaT)R@i84	K(zz;S`@9?qT_CT!'h''@(R)		)yS@9JQ_%qTI	')qaT@94Rl@@8kqT{	$cSC!9?q`TcCSC!)5qTq(B){A@9B|;U@6%"R%J@94Z_+!T_+qaT@%"R7G@_	TORWQ_PgOoN{M#_%?#{O4	1 &$'OA{¨#_֠
?#{og_WOU;ը@6ȮD@
RC4:&wTȮD@T
nȮD!DRlT4B%@@3!4R\9	():	3Г*4R:s9RZR#@rTȮD@!3&6@{T{khC_*=Q_kq@*T@R@@_	TOGWF_EgDoC{B#_(A%R\	9u?#C{_WOCT;Ո@Rs@@	TODWC_B{AC#_(D5R6RR:	}{ji}@4Qqֶq}kTkT!;h4:@1?#{WO6B%HRJyd@97@u!04!	4h
@h	"*I*Hq	+yhhb@9 7*-(	hb@9H07(!7*4 R4R724! R38h@	)AWAr @OB{è#1OBWA{è#_е:T
@`c(@\	@RȚ9(C'A!R@?#{WO5B%
@@T))q	
	?bTo $R*OBWA{è#l?#{`@( 7r@T(A%	@@94{#_(Dh@?֫?#{OCH;	@)@i@@	aTOB{AR#_3sb%Rh"hac_$A

@K%ɚ7)?%T**RI	K?qR	@H	)A!$(?#{o
g_WO[;h@oA*4g@9 7*S5C*49*G4g@9H7qhR)3 6R@5X7A@q*AT!AbZAR*?qT*YkT.!T*JS`5ZAj%RP*qT**x@9T:R?q96.)i%u7; !\q84+_q<<`*>,5@.5*S@H74vh@_	TOQWP_OgNoM{L#_ֈg@97B=	!)T@#@)R	r}S	Ju1T*Z`Qk&8g_$A	
@)u	
_$A	
@)u	
?#{O89S;h@oJk>+=#>~=Ac,C*h@_	TOQ{P#_#?#{WOsARֺA@ ^@95A
@ 7@
A
@ 6i@95,	@@5OBWA{è#_HR@TA~@A
@!XzhU69}`OBWA{è#%+q@uD?#C{O9:S;h@oJk>+=#>~B9=ACRh@_	TOP{OC#_֝?#{og_WOS;h@9A(@77 @!p
Dh@8@@Aւ?3R!8%K`4!T2:C#
T@ikh8?)qaTk(8@i@94*)?qT)%Q?qiT49@85@_C#T1h@9(4!8%4*b*1!TA9**@!A1@439(c@9h7q2)
"43q+T*iA@_`Tc@5A@:o@T@@_	ATOGWF_EgDoC{B#_@??#{og_WOW;@*R*
AZ#@@@49?֢!TR(k@?AR*qTR(k	@A|@`?R*qTR6k@?ȂB9!9?
T@!A)-8J#~@@_	ATOSWR_QgPoO{N#_ց_$?#{O89S;h@oJk>+=#>~c9C*=h@_	TOQ{P#_S?#{#WOU;ը@\ֶA
@@n	)A(@@h(7*@k7_h(	@9	4@i6)@9	5a)@9i5!`i@9?qaT@9(
5b@9rTs()qk
Tw4!(	5@ 771T@cRR#5#M@AC T@9aqTh4	ѩRc@9J_q+j
K_qjK_iqj
9@_JFT
_8_aqT@_	TOFWE#@{C#_@h6(RȚ94=&)3J!:~A??#+m#m{C_	W
OU;ը@oֺA@9An"@	qT
q	nAT
@@N
@@"@	N
@Q hb@9
N(6@6@@9
=1T+@*4R#m+kx@``k)ks€Ckxb# acTb@9H7@BR*?@@sFh	R(kTt4@(x3xqXx+	TkTA*_T R[skTI!`	TsAg	`!`+)`T`!jdT7R!`mT`!jTqT@_T R7@`Nb	` !`+)`eT`!j%THR" R974kTA*t_T RskT!A`T R@]	TOKWJ_IC@{G#Fm+Em#_ր0K#?#{OR`A!@B2OB@{è#]?#C{O9:S;h@oJk>+=#>~&C*=h@_	TOP{OC#_p?#{H;	@6R	8KRrKR#.|cυ-2?$qi)8
*T#Kii8,)џ8LTIR	8@_	T{B#_@?#{WOT;Ո@Ao3
@A R@JֺAaR*
1`T
@xR*5
@V4
@@B$`Rs@J@BtR$RZh@QZS/4R*+qT
@Q5@J@@@	RBt`Iz{A!<R${Az[@@J@ABtR{A!Af @9qT 5@RFh@yx @_	TOIWH_GgFoE{D#_րh7?#{OCS;h@RA
@9@R*A@@(R*@@R]1@Tb@9 7**n9x.@4!01R]BA*@b@9h7@959
@!'h@@	TOC@{A#_ք@#?#{OAb@9sA7aB)R?$q(9eh@H(R!01Rh$`<aBA`C!($4@@?3C!,(4@a!0#4@!t$5__ C!@
t5C!o 4@`DCRB'
C!|b@!4#R@$B((@@`DR=B@'AB@!;@*TST75Rs>!:@R@R@(HS@I7@q	[@'@H#	HC@S:H'@C@V@`H[@*R6R 	@z(HRhIHC RH?@@hI@J7@@S@"R?rI3}d Tt9A#F@S@h}@L`A'@HB96sTHC9IS@J[@r(}
@@o"R07@@C 5#@
!@qT@@5H@TIB9J7@?rI}	uJBFH/@JB9	2A36*A3@@S@~@H7@`TJ@KB9I;@JJk7(@qTA'@FHB9h6@S@A7@"RHB9(6@7@I@J;@)IH(H;HW Rw_;IS@	T*pHW@H;uHW@h RiHB96@@o7@S@@@@/@@Mh@_	TOOWN_MgLoK{J#_A'@  RY@+('(AC@HA>?#{g_WO*qkT*9RzxR 4:#@*zxJ@5AT@9(5ODWC_BgA{Ũ#<?#{)A2(9?#{OsARRaJ@bV@aNBiR@h@q"*gTiR@jk	JJ@*Jjj+jV@kN@l@Ba_	bVaNhJTb`J@OB@{è#_aB@+?#{_WOT;Ո@#@A@C5@5@@	TOFWE_D{C@#_AAB@!jK@sAHR`IEr()bbR(`A@!@@bRa~hy@!NV_$@)@	k@T_(_	 }J_?#{_WO*RL@9+R}q,TQqMR"T
J*qq TqMRTqT-R+RMRl4q'q맟*q-qE)w4HR8vR619,c@9hQqT9a@9BR(kh89
sqTpq@Tc4qTc878w4HR89ODWC_B@{Ũ#_?#{O89S;h@oJk>+=#>~ccdC*=ch@_	TOQ{P#_ַ?#C{og_WOV;@ZAIRHk@9I96 R5H@oH{A)RcJ@	*Syhz(j@9_qaTi@9)4h!'*(R57h!*`1T@	@9?qaT@94@	@9?qaT@9(5h[@
@q'Th@
@q'Th+@ik@	!Th'@ig@	Tc_93h[@i@
@q)
T?@qT(R-C*cywa RB(~khi@R !uh
rv@@=.@	QJc@9i8q	.6h@	qkTu@<}@	qIR"@6({ws"({7Ti@*7R)i)7 	@[B)@	kTk9c jT<@:@hEi{~@sKv~@Tw	`4A*a@9H7qTA@L<	Dyu#***Q(@yu(@y{s***EqTDyu@L<
Dy{sZA{A(Rh'

Dy{sZA{A 	@?@qT@qcZhRoZuah!Z5;1TccoD@%D@
P9c 	kATkT~@N<7R Hc@9H7Dj3	yt@"
w'"R**@ytkT TkTs~@N<7RHc@9H7Dj/	ys@"
sw'**(@ysb(skT(@@[(@@X @V @T@h'@H9@_	ATOHWG_FgEoD{CC#_1T'6`9A	%@?q@T5Aa@9h86@7)A)a@907!@H5_@l,?#C{	_
WOCW;@4hB@
@qTh@ֶA@7BhB@
@qHR,:(7
@A	yi2o5(@9H4
@*RH yh% n*V5@R@_	TOLWK_J{IC#_*_$@!@?#{O_8q!TH@8qT@9qT()OA{¨#H?#C{og_WO[;h@A@(Rs:Vzy*	@9?qaT@94.	(|)  i(*9R7CO_*g_o***zy`9+HR'9  @*] @*YAc@9h(7sA6R#@!RRM#@` !RRG@T'#@T(5
@9j4)T*h5h 
@94)T*)R	(R#)R	#(R2jl@9m`9
k@T'Jk!T7'5'@H'4'RRfAH)R?(}@ITm
	)kT)	ITo
	 ՊP!nN	*	J
ym_LTQ4,~@я
g@9o876R_	JTkjT
#@y	
@y		
?
ǟk맟)*?j{64H|)
@AH_(T+
@IB6kz*';@076`<@ 7@`#@`=c@9h 6@(@!@-@#pk@96`|@	@)A	mT		*@_	T*A_T@
T)?)ş_)_	)
T	RR	)ћ@@?
kT
єT5R	9@@@
@k@9:	ˉ@
ş6`hM@W`	,Fz T@@ -	<R?@i(	7/Z  -(R+A`- j@96`|@RT@*@@DQR@ @!@@D@R: @!@#@D@bR4(@?Tk{!Q"@@DR(9?{TA@T@#@@h@_	ATOHWG_FgEoD{CC#_ָ?#{OAb &Ci|Ӡjh(}!%&C)}@|)j(&CiOB|Өjh@
	{è#_?#C{og_WOV;@*** R*AqTa@9H6b 
@@JAt @J1

@)(tR8R	7)RZc C
|Jkj7r!@i`{({(**(R53@
@qAT@)
?@q!T@@,XH`T!@qT@)
?@q`T?!@qT@q?@qI	J6CD@|%Dx,@`#@qATdB3,!@@`++a@96b @
@JAu @J-
R@)(u'bB,3A	Ra@9r(*7	!q@@_	ATOXWW_VgUoT{SC#_?#{WOV;@o#bbR@_	TOEWD{C#_ֲ?#{og_WOC9AU**q`T(k@97:RHqRh*}kmT6OFWE_DgCoB{A#_@сz**(g@9h6 Rzxz{	kMT**$qT1T(g@97RrTzxz{	KkKTkT@7_q`@`9OFWE_DgCoB{A#\?#{og_WO	I;A)@R(RZ cѩ>*~}\z;~~?@*-@**؂R@H7@*	*O6(@k(ThŘR~̬r})	b	~}vA~~z;
@n(@Azk(	j@+@j(_6@+@}@Hhy,)@Q*yl)hI	K?qAT(@*;R	7SH_7*@JJ**
S
+T
*t"}@cRRh
SH_q+T(RA*aT		jk	J@k@_kT
}kjjky
}kjjk2kj*
S
	KTC~!	CHq+T^!SRCh{9C9"?KTqKTj2+yhKCkTdRR|!@@R6X)@q
TA*R-Ru
N@	4H	Qk!ThŘRH}̬r})	b	}}@@@*<}@x
	@_qJK}kT5y**k{}@@kTyzyk@kT
TjQKqk?kk}T)67Z{@_k*T4h}@	z(R~@k
T)T	@*}@z9CHA@(	kTzy
)_A*^C~!Xv
%@)J}@iz*@	)!(@)1i
	(kTzu@qTCHq+T4R_Rit)4@~@@@*	#@iz@@*		H@kTxzw**@@*-H@**'J*j@Tz7
O6CT	xzt	kTAk	*kT@@_	aTOIWH_GgFoE{D#_ւ?#{WOS2"
P7ֶA4qT@6(qT@@RR1T@q	$Q?q'1(q*T@s2HR	@Qiq'n%I2j
*vJ*MR*6Kh6`6?qbTW61Tq`T@R_q	R(sz_i	
3**OBWA{è#__$	@*@ 
k@T_@)@y)y	K_?#{OCT;Չ@@`BR`@@94*@h R@@	TOB{A#_?#{;_W	O
Y;(@$@9Q
qT))0+ih8J	@֟$ը*@9	q@TqTu"4@=`=$#`44*@9%QqhT))0+ih8J	@֟$#@($w@a@`@kKT@R(@_	ATOGWF_EgDoC{B#_֙`T?#{O@_q
kT*JQIj8qT)
*
*5
"4A|@i@)iOA{¨#_?	qIT?#{OAa@97|=ДF-`@9qT4~usOA`$-{¨#lOAR{¨#m?#{_WOI u=ֺAOj<AaNTA
@@b@9h7 R***ru88*qT1
@@@94xB@	46K@8)ql2z+xTh6B	4K@8)qzkx2z+xaTB	4K@8)qzkx2z+xaT7B	Q4**@8h8}@Jj*8jl8B_qjQ5AR*4*@?@TqT**l@9zxI6,@7kaTI6H7
(8
**JkATq+T*K@9)zkxK8T*}@ RR**5OCWB_A{Ĩ#յ`|?#{og_WO R@9
#4МA89к* RVRR+190Z#(kT~@@9	@8KqqT?qT
-RRD?qaT
@9i4?*kT;)8k?k{T*Q_%q	T*qQ_)q(T+kj8)	 ֟$ՉRHKmqAT?qTK{i"@9@n@k!@9ʫJk@)?)TwmqT?qaT	-@84j	;8
*@9?qaT@9?uq@
T*R
K*Q@9Q2iq2Q]Q)q΁kTJ9	q!T	?qq	j,I$	;8iA?	qT?)q`T?q!T
;Ki(8iqT{?
qhT?	q T
;Ki(8iqT{?%qT(R!@R
j T
;Ki(8)qT{(QqTj@?qH+R;8!TKRh(8JRhKykRK9
R
(8-i
;8	*
@95O)Q?!q(Tjki8J	IR@֟$թR?qT@JJ@9 6j;8
*T?!qT*qcTqTj;8
*qT?%qT	;
+L2ql9j9!Th*&$R}$	Rz$iRw$ՉRt$ՉRp$)Rm$iRj*{OEWD_CgBoA{ƨ#_@4-$s?#{OA	
@i6)	
ДA	7	!@?
qT		@*@?	@@!{@(@94a@9@`OB@{è#_@h1D_$A!	@?#{og_WOC{AARic@9w*?rRSRR*7@4h@|T|@@9_qThc@9(686<#ZcRHqTH}qhTi@)qTi6RRZRJ_%qj?
T*D9T|@ R(Rh9@OFWE_DgCoB{A#EOFWE_DgCoB{A#_?#{OA	@	@JAIAs@OA{¨#_?#{WOK4ֶA@6i@iB@)
?)@q@TеAaB@@Ob@9l6@`L4&a*@SOBWA{è#_?#{sARIRh@`
@c"*(*3i9h"@qT@a!8%*{¨#@{¨#_?#{og_WOCsA*h@H	4МAA3RS%6R5R9R* R*?k(qkT*@9`9_kT@96M@9_(q{T?k!T?qTAз_@A7A@@OFWE_DgCoB{A`L=#)*a`OFWE_DgCoB{A#_ֈc@96(R9A)A?ka@)@@!:"]?#{g_WOV;@sAh@Th
@@(h
@@"@@#" 4 *}SN45@*5AR1*@4R~@@ @A#Yt*~*@@_	!TOFWE_DgC{B#_֋?#{O?qT?qT5Aa@9(6A
@h7h7 ROA{¨#ДA@77 R@(6OA{¨#_?#{
og_
WOW;@ШA@@@9ֺAqb(@#@ш#3yh#@ 4@4`@	qTk@9H6`?RcR* 4@R:@
@qaT;RqT@7*@6#@?	qT;5	@R	`TRɺh6@)' a!8;Z`4Ⱥ)9RzxO 4:#Ⱥ@*ȺG@5!T@94(Rzk@9*k TkATJ_qT
ʺ@!J*ʺ*@85B9h6*V@AV#@qTTR@Ryu(@944k@97|()nk@96	@	?8?)T(@9q`T@@@9qT@R!T@oC,`5c@97@9IR	jT*5(7@.yR(9 4H@IqAT@V@	RrR!=G{4@}#T@P@)A@@ @!(*``4@Z/6*@@_	TOOWN_MgLoK{J#_`E`A`>5@|@>?#{og_WOCZ;H@@h
@wֶAh@{A*@xi@o4=4hB@
@qTiB94`@vyi@*@)@q	@z2?
Th@i@	aTt@**7`5#@)@	T'@i@	aT*`4***!5S@
@q$T7@06@`4@7@@R	@R)r

RY	
99)

;+bB@H@q!T3@o>=<;!4B2*54@EqTR*|@1hTCn`5X
@qT7@	87@7!@qT@	5i@**07cB@*h)@qT@*RcB@BHR**7**&hB9/rT*Tk*(8B9 7A"R!L(E 5*KT*_T/@*`3<.hKT3*sk@+@ֶAD***o5*W*(RAk@	*Q!)QK4HB9q T`R<RŅR		9
5x91T*H**ֶA{A5,*++@@Y	;@	4**64B)@qTBAR*54**'4@	qTA*5c*@*@5hB97`?hB@
@qT`( Ly9_7@h 6**4hxsB-kw8R	@|T:A4b@9h7sAc`2R_:@_	qkT:@*k",R}@p@ozmk	Th@	~hj*	*
*n@kITnz-*k!T*q}:
@!`3@@	!TODWC_B{AC#_ր|%`=?#{O89S;h@oJk>+=#>~Cc-CR*=kh@_	TOQ{P#_ֿ?#{_WOCV;@A	9?qTkA**w
	9
9@9Q%qTBR¾(T@5@j8@9qT#T@
x5@4T&@)	k`@@	TOEWD_C@{A#_`m_$@)@	kTiT R_@)@	kbT__?#{og_WO	I;(@@hщjh8?)qaTj(8ZAH;@qTA9AUh}
khRi}kiIQ_q>T)@@zhKH7	(7
@7*rt4(@9(4(c@9H87c"RdR`4(@@!@9^@@q^j(A^q8*h6t5(*x
7^@9
4_8R*[a4C*_	@94c*^_K{J4+Tc*}J~q
ğ8
w4CTT64Tc*}Jqğ4^cT__@94^@K	kT@AKA;H@)A!@_A*"R@H;{T@R@(@_	TOIWH_GgFoE{D#_(@@77A"R@b?#{o
g_WOT;Ո@sAi"A5@A7G97)Ij@)]>Jul+ik,)R3+@9q!@(@7Y`h@H6V%VA!$"R"'@`@ho3=*@8_q7`@94@o<=@	CR'A#u@9qTh
@@#@@jRJr}
f#6=6{AwSR@9h4qT	@8?9qT9R9@9h4R!`v@9q T9qT#@j98AR9@94@8(4*Q_%q(TK-@89qT	*
?qT*-@8_qT	9R@RHc@9@6@@%"Rp@%xqh@_	TOQWP_OgNoM{L#_`-Y@@4?#{_WOa!RC*`4ARM`9@8q%QTqcTU%`"R-2A#R4OCWB_A{Ĩ#_@%8OCWB_A"R{Ĩ#OCWB_A{Ĩ#?#{O89S;h@oJk>+=#>~cc,C*=h@_	TOQ{P#_?#{A	@@!T`@@{¨#_?#{WOT;Ո@A)!*"@ =
@q=@!	Rs @qSӷ@ @(@6)A@)	@*w@@_	TOEWD@{B#_֓?#{O@A#5bh@A@6@j@?

T6i@ij@+@_Tk@,@	T)@	H7hB95hB@
@q ThF@	qT@hi@
@_	T
	@k@_T@Rh@h@@hB@
@qTiB9@I4ш@	R
RB@Ih@j@ijiaI	ih
@I		@(87i@*7iB@)
?@qTi@@*w@
*OB@{è#_֩@(2?#{OA%@?TOA{¨#_֨A
@X7vRJR,R+RI|
(_T
)(ȚH!(*!`<	A*r@92@OA{¨#OA@Ё!$>{¨#?#{_WOV;@A
@@STs9BxRb@9(7
@yx@9qq`T5@9qTC!RY*qT*#V#@b@9h7@R@_	TOEWD_C{B#_ֆ?#{WOA
@h@H	@9?qT@95@s"~b@9H7A@@j@ö`@Ro`@`@A@@3!6Rs" @h
3yS?@!OBWA{è#_?#{_WOCT;ն@ֺAI)Y
*pAh
@@s>>@94R@
@{wO7*
@!qRRs:@@@!%!T!RP@@	!TOEWD_C@{A#_?#{og_WOU;ը@ֺA)A@)@R43#	iB9h@7h4@H4h@i@@?@	q`T@$#*hhB@
@qThB94!R@*5h@hi@
@_	T
@k@_T@@5@7@[ih'ih#h"(y=***g=OKH@8qqqY	
T!!-KA4A!P><4a!-7 4a!`
2`4A!-4A!l>( 4A!# 4A!& 4a!44A!|>4A! `4a!(-
`4@>4a!h
4A!3!4a!- 4A!3 4a!>'4A!t;!4a!=` 4a!0=4A!	 4a!4a!%4!! (4A!
*4a! ,4A@9RK@[a!+-4A!`,4A!544A! 44a!%`64a!34a!24a!`4a!4AC!:44c4K@	@9?q\T?qA\ThJ@I@9Iz5q@TqTqyT	4qEA)R	:@q xT)A?q(78**4qvT~@ѨAq*iw8Sj&)R	*)A*R*7hB@/@
@qYSqur564qA)R	qq@z*@Uq?q?q4w?qg@g4h@9qHR4hB@
!@q	T@q
Tȳ/@*u
w`O@5|J4`J@
Y4`N@JB4hB@)A
)@?q	RIz	@8
@?qH@9/@_qTH@q!TO@(*qT"3c
@+@@*4v/@"R*+q;R{A!/@4_qT*BR@@qqaT@41 T@V*jVqh94@*9@8:{_qIhB@_q	Z?q	
-ATqq<*y4@<@9qT4 1*SV7	hB@)1)Y`
	k	T94i>@hN@@<)hF@A@9>s٠mK@R@9q0R(r:4Q(|8@	Q
2?iqA1'1`T*@=h:8#={A@A@@	@*?aT*k~4+@@@R@4`F@<@9sY4@{)@K@)@9?qTkk
@za4@@@*Ykǟk
@zS@(RfA!PK@	@@9)	 (T$4	@9D5@Rܿ@DK@@R,5@9տ`CK@	@9!4@9q!T@aC#RVh%K@a!X=@4`<4a!
4!
`4a!@@>5o;<;+4@?@9qTqqT*4*?@9qTR9@9q )T*Y*qT**;`;@?uq9T}@RY?@;@9?q`T?qaTRr	i;@+@?q@5 @?@??@?qiR	i;xT(4Q!qhTkQ1jyhx)	
 ֟$`B@Ѻټh(Q)qhTk1jyhx)	
/@ ֟$`N@,?q!	TR(i;8zN@S$պZAH@@99H@;9E$?@	?@9?q-TcHѺs9$ՈR(i;8zJ@3?q,T`J@ʿ-$jB;)h7$
R	i;8hB@p$T;?hq!(TL;@I1)::$;@|H@g@gSc!4@4/@oo>=<;@pK@	@9
4@9`4OhN@i@	k@9
4`4K@@9	q	T*@?qTD@@A!| @4
RA!#[@9RA!| m4!!h`4@(@%([{x@![{x[A!X
T49;9QY*	)a2(٨ i@r** 5g7@4g@5ARhB@
@qAT*GA@d7@@_	T*O[WZ_YgXoW{V#_%`L>@ d.ֲͽ!@9`Ѳ@ Ͳ .ʲ$`-Ʋ`(²@))(`!@%1(K@`(K?#{WOA	@?1I	
7@ֶA*@T@@4s@(44_Ț@9*Ț9&@@&@H4R&@&OBWA{è#_?#{O* b  YOA{¨#p?#{WOW@9q`TqaTQ)qT*5J_8Q%q}qTqTয়ןOCWB@{Ĩ#_ 4 0?#{_WO($@)6
@4
@A@1T*9Rh@4@()@*8R*B*
*9R 4)Ј)Y?q* g4h@
@	}}Pu"@a@7}&
@		@z5@h"i@j@5(*(
S!b~}hh}h@(I
@!B*ٿ

x4@*ODWC_B@{Ũ#_?#{O89S;h@oJk>+=#>~ccCR*=<h@_	TOQ{P#_֐?#{;g_	W
OW;@#)'A!@Jak)q/+T		@3@3sRjK	
@J!k}'
/;th6r@IR9h@@h@(R@
et
it
J33JySyS
99(@@9qTh(@@9qaTi'B*h@hRh@"@'BJQ"::@T@h@95RZ@@h@n@97AR?8RP@95@7x6(@@94	Rxd@!@b	}S"a3v9@@7?@@7"@?	qkTj`6@RQ`(ARf@p7cp=R*lt@4#Zy"3s:%R$4 4@@"@	kTb@986@h5@q9@_	!TOFWE_DgC{B#_ֿ`'į?#{og_WOY;(@*ֶAO@Ap7	@)	i)q37"R*,DOA!T*N?B9C#ڻG@:T##B
N9R=9TK@
B9ikh8?
kTGk(8K@?@@#@@*)7A7?@@==
}@
N8R=@(5<n=w4fHc#R		Ϻ=5@@	T*T#@@	*T@84AA'@
4'B7@H6@K@o?`5K@ @)@94(7պ }K@Wx@8R}@#B*
X74zO@)R	H587,@7H7K@7@i	Z	
x7O@
5O@H@c@@	@Q@#R$@O@HAA#Bw5@K@@ARb n@906;@@aK@3@K@@
@	A	K@@)bhx766@
H	O@	4 ?LA@A*85@Ax6@iHi	_	TA#B{<A#B7P7*Rp@H@))
?T@K@k	
T*M_8JA}J@
l@9	rmk
4 @
@AR`%K\"@?{ T@	R	r
R		?
@Ti@95@{	JAJ@@mkk8
J@9}_	r*RMk
7);4@	R@@	r		R	T;@_Hi		T	K4B9j@D	@@ѴK@@R@@@*,@@@(	@K@2%m#@Kc	G@	K@F@KT*{c@A(R?jhK@۸b@96@TAC##@B99(#GaT@@4 9@f@96AR%RO@cƻ@ 9mB9   K@@@(@_	TOEWD_CgBoA{ƨ#_ R* R*VqT`"R**8KCG1qTkTkTOAj@9A/7(ROߚ9vN?#{WO@A	@)	ک4hB@
@qTA!@4s@* 4@TA@}
S20ֺA^CWt@*ݼ4@W@Ut@*Ӽ4@Uh@A	
@i7)j	
Oa*\?
*OCWB@{Ĩ#_?#{_WOA**e5g@987Bk@906A 2
E@H76A@05@-@
9A@x!;@۸ B9k@9H6A@5@-@0͸@(6)Aq*)(@*AODWC_BB9@{Ũ#ODWC_B@{Ũ#_?#{sA`
@@	@9?qT	@8i4׮h"@)Aj
@Q @!h"@!1{¨#2?#{_WOֺAA*b@"@@?qן)

I7h6@4@8P`'L@~AR*0?"9jh8?)qaTT_!T Rjb@9r(@OD_B@WC{Ũ#_?#{sAh"@4h
@	@	!i
@@{¨#_@{¨#?#{g_WOZ;H@ֻ*t*ػ*ܻR͹@ATB)@4@ ***{Ah@h@6!@"@`7#Rh@`hc@96@@`7#RBA3*!AR*7h@7	(7"@#@Y9/A!@@!!<hc@97k@T*J@@@!,!Lk`T*N@@@!,!h@@!,!*qTAUV7**.nhkTG@@{h@kTXqTCY@4 :[.@@@7*YqTA56*>V>hkT@@*EzhP@kThc@9((6@!D!%1@h@IJ)7JY{`A8@RuH@_	TOGWF_EgD@{B#_ 
2 P
_$ՈAJA)RR	K
_$ՈA)R	
?#{)A*)a@9 7 `5@{¨#_@R6?#{
og_
WOU;ը@A@As"@"
@"3yh@oi 6	qT53(RsZ"AJBR?CH?4*##@	
?@qTb@9	 7"@?qkTT*)22
@
@q:yxTA@(06	@@6 0) 7ɵ{4@hGb@97sb@9*h75*}@4\4@h(22Y@<4@@(7
@yx_`TH?`TD"T#@A!,!@@@_	TOOWN_MgLoK{J#_"@"Bl>?qLT@
 T	BB8@6?#{g_WOT;Ո@)!* =ֶA=@A6uIR R	@@4h7n	@R	r	@T@hP7@
@	`iR	aTg	
R*7Ѽ*@@	*qhTHR*@6I)Eh6j*ah(
@	@?(@R!8 rRR;R@j@BJ B97@Aۚ9_@!@@@)@)(@!@	@@`@_	ATOGWF_EgD@{B#_o?#{og_WOX;@o1<;T>=H@A**@*!}S2@S@hB@
@qTh@j@9)R	jUTs@@)R	RTH@(Uj @ h5H@hH@HA@aTj@9h(6`JAH-@	I-h4@Rc@`6@hx7c R46CѸѠztCjhkh4.)&I6k()<6	) 
!aTzt9@!TC]s})A
**C***qC@)
DRq)
r)q)
TI@ICR8@PCѬ@AIR	@r	RG
TA)@	}S q(12_q	T@**[	b~*cɳ*yQ**|@TzhCvc@[kbT		A
xh*
k	TkAZ	x(k)@_kT!TA*A*[@ThQ*qsшT"R*[@**@6'{)K?/|)W	K7
K[?q3hQ)h+UZ_qC;HUZ)@')/S*z`C@k@**5@h*@At@qT'@@hj@9H*6A)RC	-@P6RfA
@IR	@r	TV(4`ѣS*V)A[@@R(yh@I		K
H7[)A_@))@H	k	T@R?_@R;(*Jy#*_@K	_A@[[h6@C@A*!@(6;@CRCG@AC*! *@	@R	r	`TC*34@((!9 C9ȳG@W@A*!,*zn@9 7Rij7f@97K@FA7@@@)IK@7@!*!+bn@97R7f@97O@FA3@@@)1O@3@!*!+J@h6@	?@(-HJI@)A @	@R	r		Tx7C@
2@qTS@չS@**˹@* *p3@C"R;@!C*!$#РCRBd!A@	+TCRJc@@CBB, A@BBːA@(RRA"C*! *@h*
C@*4 a~Sb)A@A)@ɳ4|*@qT@	@R	r	@/87r@96o@@*`4#Rs@_*4 a~Sb@!*!$*45|#K)?r(_`T*"{*aT_@h4@R@@'@@7`@	@@)
?@qT@H6N4`@**a@@iFh6iN@iFi:@
R
r
)Ai:`T R7hB9qTOBWA{è#_?#{@)A3
@)@7*s 7
1@+1@_T 7য় 6
E@+E@_TT
I@+I@_mTjT R5!z@Z{¨#_?#{_WO	W;@Ao@	)#*`r`TuֶA@P6h@hh7*@;`@	@R	r	jTF@2`
f@9J@h7|@)#!`f@9N@h7@)#`B@
2@qTR@%|@2@C"R%`b@9h(7*:@CR`n@9h(7*
@@)#W`@_	TOIWH_G{F#_փAe@907"B<u*}*A	m@9*7	Ț(h_)))	Ț*}@+ʚj
4K}iTHQȚhh)	_։@)A

)
@_@qT2*
jR_֩7$*$_	}S)R*
_%qT)
@J2Lii8k	R`֟$)	R	jHR_֟$ՠR_֟$ՀR_?#{#WOW;@)*)$qB*o#B0>R4_8qT!T>R 4:*@_	TOFWE#@{C#_?#{og_WO	Y;(@*sAoh@H87_qTC96@(RRC9(R:C*ij@91I6@qTֺAC5*R.sc8x@9@*ȯhx9*1T(e1`8ih9	c@9B40 ZsT@ChKkˆ~@C"RR(@_	T*OIWH_GgFoE{D#_C	*@QJ}S_-qTk	3mij8	
*@$R֟$ $R_֟$ R_֟$*$_֟$*	R
j T$R_֟$Հ$R_֟$`$R_?1@qh$R?@q)R __$B_$x?#{WOеAШb@9F@A6@p7@?R*3*!
@@4!&#@`*2-4_	@OBWA{è#_ց@ 6K?#{OДA@`@s!!@4A! +߯4!!0گ 5#c"Cc7H0-
@!
(@9sAqaT)@8)4h@2AAT`R*ή``
@OA!>{¨#՟#c8%
@ 6ߣ@ۣ?#{O89S;h@oJk>+=#>~CcH>=ACR*Qh@_	TOQ{P#_֥_$`?#{OДA@
@	@9?q?qaTAA*دq@ij@9_)qAT@	T_։
@)@9?qTi@9?)qTRh7@@@HA	5@:@ R!OA9{¨#U?#{OsA`@Ÿh@`"i"@h@`&i@9@\`*6h@@9KHRh*t@@9@A@(77( 7(7(0786@/+h.@5 P&
@!h2@H4OA{¨#@x@6@@('6
@/6 P	@(76@p@?7?#{og_WOCY;(@@9
4ZA45H/@A6/{C3q	Tx1	T@9*(Q%qITqaT1T``x
BRqlTqATq@q	
7Qq(T@
qkT1@T(Rx
! RRRH/@7)H/@95(@@	TOFWE_DgCoB{A#_ ?#{WOֺA*@*@	mT*@*@(**@@?TOBWA{è#_֕A2@@f@9@)K6
@K)iA"}@*7
@h 
2@@?2,TOBWA{è#â?#{
og_
WOU;ը@)AֺAo3
@2@@BT@* fsP7@*@T2@4D@@56@(
4*@~@2	*V*@*i)a* yh62@	46@*@2)7*5.@4sA*C3O@.@s"
	JQI
?k8#Th4SRs
qTA_*
C32@?qCK%طk*+T@R6.@Z_cTȦC&@@	H*@h4@R'@_	!TOOWN_MgLoK{J#_ <"F)6?#{_WOX;@@qLT)A
)@@4ih8
45%R*I)#ih8BB|qaTA@R	L@@(@?@q
T? qT?qAT@RRfk
	Q@k*uj?!qAT	q@q(T	h))#B!X_(qS	(!Ț(*N@*(4JAM@@il8
q})?!͚!TQ}q#TB400qATR
rh3*@	qTR+@TiqS*Q$ʚ6
}!ʚ!ɚ*@4R#R=RRB
"B%*"B%R@_	!T*OEWD_C{B#_<?#{sAhb@97AI)	`
@c0,**Uhb@97@{¨#,@{¨#_?#{4!!TA@sAi
JA(h
@y)qTAa@96@R
@{¨#_Ҡ \Ϡ?#C{og_WOH;@)AֺA7
@8
@q,T@5@@_	aTOHWG_FgEoD{CC#_֜AS@*)A@4yhCCqT_q85N*A@`T7A8Ry5
4:R@Q	@9I4)@9?qqaT@8qT9)@9?q5*3bR#qT@B *4q@9@?qT585Уr8I)ki8@( ?qT(R@}@"R5qT_hQ@"RHh8:R)qhK}@_**:R
@@kן	*7x7@RX
@@qן	*7j?#{og_W	O
CH;@9A>(#@3@A	qT(@@@`&r@o6@rr@¥L@*c**8RtR(4ƪ4Qs85qaT{5(c@9h96h~@;Rk(84*Z@95T>=
qT@9qHT#Ț)	T@9q@T@@9qTvR? R 4 ЂR/`4qTR%y`"46RF@8qc4@Gh@94%q`TsQq
T (&@
qvR&T@9qTb@VRb@&@(H4(@@)!B{';@**
%+*	@K@9qTis8kATJK@8ql%QTqcTK4J@9
4_qJ%Q_qꗟj


)@b@q	k맟	qZ**
T*X*9@9q!Th@94gh@9qT`@844	?qqTqaTCR9_
9r9aTh@99ih@9	qT98R:R@S*(g*]tRީ:R
"@JA+Q?qJe@9_r(**+j@((is8(@	@9?kAT`?*H5R@9@ytR~3R*@C*+@(@`
@`?4k
T(@@9qT9@?:
7s@_aT
b@4klTCfy_@*@ 9A]@8RyCBR&S_	@9?qTCBRJ_	CBRD_"	@9?qTCBR;&j@b1`TVR2@:@C@(#@K@4@@N(@@=(@|(@W~!!(	47@	4(RIH
H6@%+ii8fD]@T8R.8h
@	@9?q Tf@_	kTn@8?qT_n@	@0C(#f9AtR_! )f@@AR"R@pZ.@4(R*4@
@8R|_	
*m@946kq,RATl@9qaTl@8)6_A)Tt 6VR	7@d>Щ7*tRv@vr@ @9Ax4(c@9H6R4!!(qS4`5*4@47@ 5AR6R7ѵ(g@9tRj7 AR(nv~-Av@*@@!0+ب?@@_	ATOJWI_HgGoF{E#_h7`LzS?#{OsAh@OA{¨#_ֈAbv@c@d"@@!A`@(R9HR! )hfDf@97`M)bΣf?#{sAh>@`M)bףo`6@{¨#__$}@
hh8_qK%QTqCT)}@+hi8)ql%QTqCT_kT5*_ R_?#{A
-@	e@J?	q
-KTm@j
@A!,8 ?
qBՊ7@{¨#h%	?#{og_WO	H;ՙ9AsA@TДNc(@WR!@*@9qTqq`T5C*ܨ_@9?qT@9Ш`RR8			@9jRI9	@9%LT@i<5R@9q!T@"؞@{9Q%qTI{y
_8@8))jQ)Q_)q#TI{9U6@9qT*9R@9BB(*\*	@?H7?qT?qT?qT9Ac@9pqT4!Rk@^C)@9S7C)2@R* @9q`Tq!T@9@R>*	 cQBBh*=C)=,c*BB(*C)@^HI@i5@94%*Л9Ac+4@h(@#@@_	aTOIWH_GgFoE{D#_ֈA #*	@@ߛ֦?#{OCT;Ո@@	@9?qT?qT
R4?q
@9	*J_qJqS`RLR
*y9
Mk@94lQ*
@9Q2iq1Q]Qq
kT4
kqAT@9=@4h@?qaT	qTh@@	!TOB{A#_րR@<(?#C{WOCU;ը@8hAa@9	7!o	@9?qAT	@8?qTK	@9qT4qT
J
@9j4_q T*rT_q`T	@8R?r	*qvԦ 5Ц5G@@	!TC@@	Th4s4@_	ATOTWS@{QC#_ (7?#{g_WOzZAH#@h5Hc@9 6[@y@xA56sRv7ֺæ4@4Hc@9( 6`@4@	q`T`@a@y@9OEWD_CgB@{ƨ#_ 8*?#{_WOWvB@t*I 4*ODWC_B@{Ũ#_xA@q@T	i*3H 7hB@
)@qTBR**4@**	qaT!9R@qaThB9(57*5c@97@qTR**ԩ4c@9h 68R*hB9H4h@hc@9h	7@R*۩4@qATh@	T**Щ 4Ԛh@H*IR	c@96@	)"@(7@q "$g]RhA)*@)>J7?qB7@q!!C*:5whA!!@1*(5?#{OtA
@@3@5HRϥ@99H4h@9h56$@q`Tj@3OB@{è#_?#{WOuA@7i)AJR*9(@7H
H7vֺA
@@(t@	Rs"G

@7@ؤE@7@@W @A9@W@7"@h (R7ZIc0R**@)R	TOCWB@{Ĩ#_OCWB@,{Ĩ#Փ@OCWB@{Ĩ#9ۙ  <?#{og_WO	H;@hA
@`@47)ъji8_)qaTj)8_@9@4`AA@(A9b:@		qTCz^C3:е!s/Z;2_R*9*Aڧ[5 R/*
_)@L4q!TqT^j@+ih8kQ%qT_AT*k	T_	)4	ii8	4HR(8_)K	)@^"K* R*h([4^	@9qq8T{q T^@9r 9T^@9(9^{q!T?9^	@9)4^;
_	 R	99)
^(A($i)A(!@(!_hAa^@9q	%QT?qTqTqTrT)qT(@845@@_	>TOIWH_GgFoE{D#_uAo3R""@9qAT	@9qaTjR7	6	Q?%qTqqTq`TqT_
	^77c*\_
	7/c@2@94hA@	Só_K		!_	!b6^*8R,@8Q%qiThRc*-_))	
^XR(@9qT
%Q_qHT)(@8q
%QT_qCT)q`T(5S_*R+
5(@9qT
%Q_qHT)(@8q
%QT_qCT)Ѩ'4(6@9_bR*9X4 &R*qCT %Q)qT)q3j+yhxJ	@֟$տC8,cѡsOhA"_9C(K*C^8:^SR)49ѡ)@9	kaT?r@T)?qqT	@9?)q`TI4		@9:@_	kT9~"KK_	@9:@	kT@:@9A46/3R*_qI%Q?q闟_)q`T	
4i7_j"	=@)
*	=^~
@9	=@_%qT)2	=?=q(TcBRqT_	=@)*	=^@9a5hA	a@9_7	@9"
S"Ri)A!@)@9i5)	=@
)"3
ɲssA`@o^	@9?q!T;$R*7`+R*1 t$ՠc9
_)K	)B_C"K*%D_cK	-/6
T_C*K1W$ճ^v@9߂qT&QqHTh@8߂q&QT?qCT4tqqT(4v@9v@9qTs7R*R9^!HR4R'8~(K0}@	h0@@	9^qhj58$jJAH!@	I!^ 0@9Ԗ^Cj@9_qI%Q?q闟_)qT	
H7h@8qj%Q_qꗟ)q`T)

6Cc?#C{WOCU;ը@wvA*@ֺA(6t4*؜@Z)R	T@*9@A9B*_@(6@H@9h4 5UZ@*@)RZ)R	T^" @@	TODWC@{AC#_[?#C{	o
g_W
OCY;(@{{Ah@s#@= #@a#ihi)A*R)a@9?
j pT#ooi
ii8_)qT<R	i)8*i@h+@j@+!?Xh+e3C	@A9C5h+@?J
7?T3	#	4Ch4	@j+@?kT?
KT?	T)(A(_T'(4]`**|	F)q?k5]	`!**j`5h+@@	F)q?k	@j+@?
T6qT(R@	A9?q?q	k!T5]:q`Tq!TR(+h4(q($@	F)
'@q?k*5QqT)zhx)	
 ֟$թC]q6TRq?kaTC+S4x@8\A9qT+V4@CqTtc+@ARBnR"RM$hc@>5`mhc@=4?q=TR$o`@s'@$`@g]`s'$h@i'@zs'	$SEi(4w$h'@`@h	h'@`	i'IR	h(8h@i'@]	lh'@i@h'?i(8{$AR2$a*94'$tkT'Ei	Akv81T(`8](i68`	T]$iA	TIkh8?)qaTAH]h38x@E$h'@h	iHRh38]a@b'@sh'@]?i38/$;@H5+ݟ"R]$ $+Ο"R$3@6[w@BdЄACR*=4**!*6R)*#@h˨uеA|<
@HV7(5]TA(@87'|uЈk48]A)CR"%R6R94	?@W)}SI4'@J?
kTC'@]CR<'|JW(%R#@*4-'@	_	6TC**B**i8_qT_qqTJ5*	)}@)*ki8JQ_%qiT*RR*K	@J@j
K
)#@K		#(-2@	k
T}@#uеA@C[uеA@#@*	}@(@**)|8?q T?qq Ti4@J7ii*83*@ k|8Q)qTCr	`)8T*k|8)}@ji)8uеA\@#)TuеA(||jh T)|@	)@@6@7JA~@u#@A@**@@	@9\JW	6]dCR%R(ˠ'|A(H#@*4#C@#@Z4R3K#C@#@Z4R3]`<Kh}@ٞ]}@[4@96]*3@h4])RC(@h/@h[@9*h_`5h_@9h/(RC
RqcTQhctkT`A*kTR}@"R	68*]"iw801T<`8`AR	6*9
(9]iw8qT`A68*
hAB+6:Thc@`A*R}@"R	68H3|B4Rt$u(R`@0uA@95+4B9Fq#T$5@iC@a@!	K*h`@]i#@hh	h#$@!h]hAa@9 7*^f ^36Rs:@@@4*1Th_@*4`[@"Ra[@*_*$ҝ"R	h_@4`[@"R\@v_^ϝ]˝(@^	TONWM_LgKoJ{IC@#_&ǒ ,+p?#{og_WO@!6@94*xR!Rr@9raTkTh4mqT;k TqR)
*7_8@9	k!T
qqT@9	4kTpqTrT 8huqAT*hr@Tuq!T@8R7@9(8@9;8R
	@8?q`T?uq!T88R@8(8:8rT@8*(8@84rqaT@94rq@T69`@?9hOEWD_CgBoA{ƨ#_?#{_WOq@YxTZ(C}@**{6HR48*~@4*.8B8j(8ODWC_B@ {Ũ#_?#{_WOwAha8^@*4Z@!!8"R5Rnq^4uHRj38TZ@aj38Z@Y aT*Z@qT`05R*OCWB_A{Ĩ#_?#{OS;h@t!RA
@@#!#q9h@_	TOC{B#_֊?#{og_WOH;@xA@	;R\8RR@RަT@@94*CBRSh9	@@9qaTCBR5{SH~~~h	@hA@@9?q`T5949@TKKQi#?@qT*
5j@)q$@zH*h9R@95xZ@AhA
@P6i)Aa(
@R(RssA!-`
@Җhf@97@3c.RFhAa@963@	qT*4RR@3W	@(iu4j~@S(y3	3"Th4h3@!HR6R*3R3@qTVR@yuhAa@9H07J 8*3T@@_	TOGWF_EgDoC{B#_*(5i)AHR,(9_$hAiJR
@)AB@?zH!!*?##m{o	g
_WO
H;@wiA)A@@5@4@U9!	n@q*2*-=7H7`7
X767hi%B)!Br(?*Ca]N]@#}_T	T!hT `&T!h( `!`T!`
T( ` `G(*oC#=n]#@Cg\`#@Kq	
R&R!KdZa( `	T `U[h@94J@9*	4*kT)@9H4*@8
k@T)
JQ_%q(T*@9KQ%qTBR]BR觟ǟ
ןXZ	kT^_8*@9J5*_8_(k!T@94]**@9j5( ` `ǟ<*N!`SZ՟*
iTР!#5!24<R`Tܚ_`Tؚ5@@u	* `cZ87**@~Z@^	aTOMWL_KgJoI{H#Gm#_֟?#{WOCS;h@@he	
@07)ъji8_)qATj)8u
@A@72@rT@@AklT@@}}2@(2@2h@@	TOCWB{A#_]"@2@ `?#{O(@*qaT@(5@5@	R	r	
	*4Gi)A**"*@l-R@*4	qT*/Rqi80}@14
?qT)&Q?qTip8?q)%QT?qCTqp8*~@4A@9?1kT1?q`T1&Q?qTip8)Q5	*kT7*6*kB	*kh8J@9
kP7tP7@j5Qj(*L@8%QqTqCT6	*	kL}@
}@)mџ
Til8)Qq T%QqT*@@,
Qk_q
JQ)_k
q`((k賈}@IT(6k@94jJA*ilq T%QqTM@A,@9	rTk(8*+@8+5*(846j@94*iKkQyqTj(8**@8
5*(8OB@{è#_?#C{WOCT;Ո@uwA"AA@AT`@	@9?qaT	@9)4s"Ȑ"@@)Q")6"@|@9S
	R	Jc`*ړb@96@h4ssAД.@R*3qT@kT@;~@ RwR*!qT@@	TODWC@{AC#_-?#{og_WOCW;@yz9AZA8S@Hc@9*65*vA @*:5(@	)h4@R_H#@3	qT 'uAR*ڙq+T6K)}`)|@lTTjj8J)q

ˁT		
kT	|`ӡ(` RR*qTBR*Z
BR*T**O!R*xR*@6R)@T0	Л@		*T		@
@)JK		
 qT
@}@jz8q)q+T@		@
@8@9Jq
T)		+qATZ_TR*`@!+?*R`4Բ4**AT**j K4i}`Kk4@ih8)qaTBT)_k:RT
K	\,!+H**Ę@@	ATOFWE_DgCoB{A#_&t0H?#{O89S;h@oJk>+=#>~`#=AcC*h@_	TOQ{P#_?#{O5|@*Jo*_q`TOB@{è#_?#{@ R@{¨#ۗ?#{og_WOCY;(@vuֶA/@A(`7HH7
)J0uT@Z2R!R5@m@`k@`"@c#Ru*@@*@@*H@s:@ѤARX@@
@@!bk@
@s:@ARB
@@
j@96.@H(R@H@!8%*4@)HR6R}	S@@ܤ!R//@>W@o5=(B	@rT
wT7Rx.@
wT@@!0?@!2:@w@!32@!!-}@u
wT@	sr@ZB4Rs"@
@}
S".@@Ta@!ARw@A@R8SqTU4*@R(\ycR	kaT@R\y
x9JHR
R
J)J	*=r`T8R5HHawTRR@@A`("RN8s~@@w@T@q	Z`7 ژ	)uJ=(v6!S #@e4@B@R*;"&&
vfUEF4R@Rn@	))w	T	@R ˘@@RڋxrhT \4K9	4S9Ǘg4RM9nMqT	?qTh4O9)4q-T1q-T-q1TeMqT@R*i@**R9!rTR@}}RkTH@9h4C94cK95S9h4@@R*;RR[R@Z3
 y(@TR6*nr@q	}?
q#TR@
yS**((I__	r+@R8M9,?Mq@Ti523)
)]8(3'@R(#@R$@R ~@RR**F@	|@@R N@@fR G@j@n@9H(7f@@hn@9h(7@@@n@9(7j@`@b@M94@R#b^@M9MqaT*@aRК4(Q((eE9)Qq7c7@R#2^@
!@qAT!P9@m2b@h@95M94@
!@q@Tn.@w^@`@R4{@!T*.@6@	Ti6Th@.Tlb;@6@@	;T4R2@x^@
@R4@!T.@*6@p7h6^@@87
7@^@@qC@4#@qTb@h6"@@o@sk9@R@CRL*
@9+@9_qAqCM9Qq(T1** RmRsoLn@s@+TC!#qT@q+Tn@?TQK(8oh5Ӏn@{h	+T@
!@qT!0,@ \&r@ V ^@6f@*j@"~@1D@4=>@+8@)*m))Y(*'@***4*l*&r@{c@RB
Vi#B)@dA)e@"	_q)7 &g^@9cb@^@Rn@v^@Pb@Nf@Lj@J4RH;)R4L@EqAT@q T@7'4A@UqT4@	qaT#@qTb@@ 5B`^4R@q!T8R1aT@EqT^@,7'/#+@qATK`4b@ h@*R
rIeA/ߠ1Tj $@*j4n@j@9 7A5@^])@n@9(7f@@9(4@hn@9h(7@@@n@9((7f@@94j@`@**&4**r+@qT@^@#m!b@9/7@qTD~@@:@:@^@~@x<*6@.@@?T	`Ts	@.@6@@	.T/B*B@4B)RB***A@!AR.qTSsA|@*x@R"qT**Q6(@]	TOFWE_DgCoB{AG#_Xc+@ks9@vs"T@H;*t6|*?#{O]4Qhh8)qK}@}`i`,ih8џql
@Th`j(8OB@{è#__$@HA@	
@
a?_?#C{_WOCV;@WA`*!*q >@(@9(44@@9h4qATXAs@9(6>@Ò@>`4:@sϋ4@@94q`TG@A@*6	>@/ R@@	TODWC_B{AC#_q?#{og_WO[;h@@R*\МA@4XA@?aT@?T
*(Rs@943@S
@R4@!T@94q`T@8qT5B@
@qAT_8qT'R(k xc@9075Ѩ@8qT!7Ӓ֞7T_8q!T@9q`T5d@9h4`T@D5@h@J@h@N'@B@B#@hW@F@R*R%B@`R-@J@`RN@`RvB0RcRňF@`"Rn҉.Ih		F@	qC
TB@
@q	T@qT[@@kAl__T@m@
T)	kaT:R@_q}
S2h@_	9TOEWD_CgBoA{ƨ#_*?k! T}@rT[@	R
R)	[	[@
R}
 i([@	@ (!
[@	@ (!
	@B@
(@Q}S%qT)y5+ih8J	@֟$?@qhR
9R@w&˘|@RqR@wF|@R$R$$ըR
9$R
92@RW<T	Rgo@9(7@hJ@J@}S(5@%A@Rc@hN@GN@}S(5@A@RQJ9qA
T*+
7g@9*6R**T@!rTS@	}}iS(T	
S@+Zy)	
S@+Hy)@		2@? TbR**dT@
qT2@
S@Iy(	S@

?y(@i
R
9qT*3	R	S@ M7R"h@	@H_qlT	kkT?%qkT(R92@R@@R.1D+pK$HR
9T+e[@
R)}ii(R(R
9Ta	RuR@5;***Qˑ*Rg@9	R
9((6@!,8q(R@@R@_'qT@R*y6RRvrYRRh"Q	}6*)c)
7w4kaT"q`Tk`T(Rc9@@Rf@@kT@R*XS@ V<RsA@@\МA@@J9I	q TMqT_q@T*b=	S@yS**6hT	S@|"ihՄ	S@
R@
|"ij*@	@	kkT@2@*}@2@	))w	TA@!A	@R"v*-6@4HAТK!D#@:ˏ?#{HA@*|{#_X?#{	97?qaT	@8a4*_qAT*Q}i) 
4	@8JQ+qT)q T@8)q@xT(2qT{#_H;?#{O@*}@ݙ`HA~@@h@48OA{¨#_?#{og_WOCX;@ZZAIH@)A*R4(4HS@i|**ii@TIS@h}}7ih7*B4Wo@0ղ~@*фT5Ho@?T@@*͖@TH{Tq`THo@N*j@@	TOFWE_DgCoB{A#_h?#{#OU;ը@#` Rq4T1ƃ@_	TOE#@{C#_(
QH$ȚH4*	$8Hӈ5#QBʅ@!	R	9_?#{g_WOCX;@*Ž#@;B>R*	@a@@2RR@1RR6@@R@#/RcRn҉.IH	@3RR4R9	IRH'鍮rJ#9	I_9US*RUAR#@R@9@R@?qY(kTA@!AK@_	ATCOEWD_CgB@{ƨ#_T?#{_WOUA@6@R!R@
@IHR	r*@!cp6RVֺA
@h5R@)R	
@
A!AR*qTSsA7R@x|@@@T9@R*~qTOCWB_A{Ĩ#_?#{*RdHAq	@	T		@)		@{¨#_?#[{o
g_WOS;h@\IRШAx@9@#@@55'4@Q#u &5"4@aE***97q3kT@!3@	4!844!P4@9qATT>m >K7@@*qT*k5jih8)	
 ֟$տ"
qAT$@	@9?qT@9v4	@9
4@h~@	{z{hi#S`
4N
4@9
@@HqhR@h}@q#rr{zrq_
4`T#W-5qrrvzzrq{JT
ATI5
$*`4,5hw	2qh{	2q;{R&qJT{sS#@skATt@@d(*1 ToHI*@B)A
qC(?1@T6qKT#@(%)	R	jߺq@TqTq!T@@9q*qT#@(Rr	u8#@?!q)YScT
	k	@3@@9?(jHRe$տן`$տǟ\$տX$տෟT$տয়P@6q9h@^	TOQWP_OgNoM{L[@#_t*ҁ́D#Ł?#C{g
_WOV;@WAo	b@9>SsArT7h@i
@ *_@\'=<`@<oA
<<@:@B@(@75(7]5`4__'A@_#5H@HCC*ŒT@H@_	!TOGWF_EgD{C#_`I)A
@9(@
*r)рTlqT%QqT
@9j4_qTK%Qq#T
*lq T%QqT@9*4_q@TK%Qq
*T*)
*_rT	@8hѩ5_?#{OHAU
@A@hi6
76!P{b@9 7OB@{è#_OB@*{è#Ն?#{SsAh@hRh`
@! ;h"@	q+T@A@!$>{¨#բ@{¨#_?#{og_WOS;h@I)Ao>(
@!T@ 5C@
!@qT3@hhUA**7R@R;;0x7{@JJAq+T@*A;(@9Ia@9)qs	7q%Qq'6*qT*3l1T*qkT
1T@3@ЏJJA*v4_:RJJA9AT@**qT{kTB4b@R@7@@s=@#>@h@_	ATOSWR_QgPoO{N#_D?#{g_WOVֶA"@5@*?
aT*qRY9A8RZ(R@
#J}@?
Tzw@C(*8*zw*{wI	){7T
@@$-)ODWC_BgA@R{Ũ#`?#{og_W	O
CU;ժ@s R@R*R*VֶAZ@ZA*H7*%}@i)@I* *	"@)3)ySI94q
T#
@݉R*6}&)R
""A	"(		*	*zjW**K		*T	*}@I@?M"T*}X^AWAC****@_#	)B@9@ۊ^^aT*	hT	H@@*	}!Փ
@@_@_'@_H@		@@	IHA
@|T@*	HA@* (7@RNjS44RH#@$!x@#*>@4*5*yHA)(*
@z	$ H@*WHASш7b@9	6WASH@I@	aT(R^q(
RqT^H@*=S)r)2I?qHT*_qT)Q?qhTiR9@+}R9A_!B^**	4	**)"	I)A!X @*@	HA*
@pH@HS1TH@H!T@#@@@h@_	TOJWI_HgGoF{E#_>} $}_$HA
		@?LzJI			_?#C{_WOCU;ը@VֺA@9	4h@9h4WA	?qT)%Q?qTh@8q	%QT?qcT@@_	TrT@@@+%_i)?T
@94_q@TJ%Q_qT)?T0@r4@T@z(@9H48@@9(5@3@)%?JT@@j
Ttz(@rsSR@@	!TODWC_B{AC#_
?#{WO6UA
R RVֶA44@7@6ӐR(r&@bB+x@"B$x@B$x@B0x@"B6x
@СbB,x@B0"x@СBx*@"B(c0
w@*
@@t!@@hx7(p7
)IJzCB4	)5JizCBHA~s@@A)M"J13zCRu~b@96Сn@"@AСB(g@@(`	@Bc0
w@@ъ@@R?TI`6	 @y*qQJ=_qT
%ɚj7)Q	 y@@g7@@h7B@BA)N@RrT	)Q!@	)A(zIp(	k*)10"p7
RCz@T@T*}q@Hh6*AqT@`zw&	&yq	UZ?kTqZ&y@t*A(T@LB@BA)@6*cp7R*AqkT`zta`zt*TOCWB@{Ĩ#__h7{?#{WOCS;h@oRzTA1`To`5@~R6Ah8)Q?%qT	}@)
)*@8JQ_)qTR6h@_	TOSWR{Q#_֋?#{g_WOX;@* @
@T}`@97AQ%qiT*BR}h@z([@5
	T"T TTqTC R*C}
4h@	h@zh(	4h@zh?Th]y5!!A酌RR̮r#(y)dШQq!0#]`4Q0qT@R0@5To7ABXR~@}@ FCj58h@@
jz(*ah@	|@z(5~@C R_58`TT"TbTC@@@_	TOWWV_UgT@{R#_Ci@@*jz)=#~Qq?#C{og_WOS;h@*_qT!R4R*	}@@	T(*	ARTK~@(	R X(?@&y_k(8cBRd&y@T@9Q%qiTY(R*y@9qTqTR*yѸ|R;DrR{(+	R"	(R"y*Z7C*Cxc8}1Th @5DT*:7T@!@qT@"y	R}	))+(ihqT(A5A"y*	RJ+)	A9&@yi4h6	K&yeh@_	aTOHWG_FgEoD{CC#_,?#{_WOW;@!RC** 8A!RT5c0
(u@_	aTOVWU_T@{R#_P4A*	Y
_j(8
ATR**#?*Ui)*j(8TR!R*w**tЎ?#{_WO@6A*RK09R&y@K5}@"y@(#ȚTODWC_B@{Ũ#_?#{og_WO7A@
:@ZA*qk	T@TRQ{&y~@q|WZ*[h"yMqTkT	kTH@6(K*4kTk(ÈK9Kh@kÜq駟Z?jAZ[6_k
T_qT*QBQ!~@)=K|5`R?x4s@S@OEWD_CgBoARHR{ƨ#/?#{nqT R@{¨#_ր4(AIR
@	Ti@j@?
TH7
pT(Ai@}@	Th@*?#{WO@(`N6ֺAvI45*AAB$R*zB00
Rvh
*Avi@K(i
@))	@~@+
@jh)@Ȣ@`@?t
@

@Hɢ@
@@ ?ր
@
*OCWB@{Ĩ#
v ROCWB@{Ĩ#_?#{og_WOC\;Ո@o4
<<<<<<=<;3d~99A @d:ZA)Hc@9)Ah7 @0$y4 @RHyu**o3'; 8:;<=><7H@)@Rnv)p(+@	*)10"
Rp7q@\T4+n}Hi?+3sAR2wrSC"M(C}D@E`FGHI!
'~	R
mS@SP m	@	=R@})qq**?*4+@[K66A@6v@A@@)@	
Ts"Q?@8Z#Qqq*
5
T@*?ր4?@8s"Q	@G*/:ZA'@*R{RI}@)C?@'5*H6Hc@937(@p1K~?@G@Rcp7Hc@9H7/~H@y4 !_y(@<<@H@/7I@)@)@9?qT/@?@oRq7
	Cyව=T@Cd@9u( 	@)	TcAgAH@_A[AkAg
L=R*]}.:@A҈.mHvH#y	Q)=?5qTG@
R?qT	)+%
E@9?@/@@zhL@kyh)z(aTH#y	}
)+8ihY'y "c$=*0.9A9A Z@**8*4AvAJCRB,/@s**oRv@
sURϒRSUr{r	})a)		K(Aa{t
?u){4[A?r)	HR(RՈ*ښ"RR*{?qT?qT

_3@RR)ښ*{a)e>#1!)?(1 A3@CRB(%~so@*5oTR6 ARBls+qRՈ/@4?@@@T4R(AoC @j	A=B=)A? Nn!T^	f?)U	&C}Ř{9c)	@!@ekx(U}
Ԛ}S	B$H*0s#Z To@*99A*R{R @/A:@9ZA4(3A*R	
*߁qT%QqTq%Qq헟
M7	kT	*i*8
q`T%QqTmkaT
{8
*
@9N5Ic@9)6	_8?q)%QT?qCT!R*9*qkT'@G@	kT*Hc@9(7zvG9v@R|KqAT<|zvQt|zvKT+H)?
T(@(`T|(@;@+@Ic@9

j_D@ъ;
7(A@|K"#Cl14R`
Tq 
TQ	Riq)1?EqT0qT1*T1TWlq!T"#C*RqLT4q	Tq`	T?IqT)@**)@y
K*)yqTq!T(3AQ(3A*Q(RrR*N{*qTJ5Iiv8		'@֟$)Q$)K$)$Չ	'@$(}
G@	k*(R@Rsu:ZA*!4R
ku7**;?@F{@qmT@@`zh;{kT@@3{7@4Hc@9H7@@_	TOEWD_CgBoA{ƨ#_.p.p{_$ՊJa*Kii8)?!,xk
yk
y+!T))AkjJ|@)@t R)}
)}K*GII	_?#{O(AJ0
@	9NS	`6(A	-A)	-
:zzOA ={¨#w?#{O4Af@9((7)a**ih8!+xjlzjkkz*!T(A	@H|@{(A	@@		(}ijt}I	G(Hh@hX7 R9NөR(hzhOA{¨#_?#{WO9~4A@^+qZmT@sBj
@B0"j@bBj@B0j@B$j@ЁbB,j@"B6j5AIR@"@	zk5)
*	5(6@g
@	@!R_ "R&@h&Ȇ@	)	*Rp7B00
R9Jmf@9862A76{*@@"@OBWA@R{è#jOBWA{è#_
So@/='>~C*=yh@_	TOP{OC#_֜x_$
Ja|Lik@@kTL@xl.ym@T
aT!T?Z_ R_?#{O@@Hh
@}xOB@{è#_))A*
|
,@_k(1Tl@,(@i!@y	!yi%@y	%y__$4?#{(A*a@97*JA$C@A)7?qJ}!%HJy Az`Q@{¨#_?#{OS;h@4Ab@9h7"@qT{!R1
@!
@"#BR
	_w@@95b@97*o|@C9!5C-kh@_	TOE{D#_wl
@@l?#{og_WO5:AZA***&99k0{5`RR*b} T*x*RR}ji
})%ʚ!h54x(R""AT*@RxH#@qן<
h6R*wH@@wqkT 
|@,_8Q)qTQ2iq1k]QAqbT
Aӭ}jmuS*
~k!̚k
j-AT@RR*}<RaT<!TOEWD_CgBoA{ƨ#_H@t0@nl<!1*l?#{O89S;h@oJk>+=#>~cC"R*=wh@_	TOQ{P#_4w?#{@HK8Q%qTVx*D*@R{#_?#{(A
@HR{@{¨#z3sA*`RR|T =A}=*ijh8I4"
No#NDNcnBNbnBNA&@aT5?#{{`4|1T-)%q %{#_y4l?#{WO6ֶA
@@*&p"RCR**wf|7OBWA{è#d|
@@k?#{g_WO5A@@91	Q
2?iqA1qn1 T*@vT6sR@A
@	@IARx8
@yx˅v
@yxBTXx
@	
)@	Rvd9k@BA*ODWC_BgA{Ũ#|@,bk?#{O	)A)!A
}A @JK2J
S35!s
*z>*{6_k@ OB@{è#_?#{OA
@@{ 5
@!
OA{¨#սxGk?#{#OT;Ո@ARA
@@/!R3сr*C&x`5
@@0w3y
@-w7y@*w#R*/@_	TOE#@{C#_֨
@L=@ku?#{A	@@z4!|v4!w4!"v`4!w4
j R{1T@{¨#_@x{¨#Ցjlj?#{_WO@CU;ը@ RwA40qֶAHR@T@6@R^{7@)R	TR*U{7@_	T@CODWC_B@{Ũ#_(6o=z#z@@07"R*uR
3
w1TbR*u"R*>vTTj 8!R=tu@qTYqT
@5@R*{*7}@@*
{7xB 94AR{y*8T*yuGj u_$A@4*1v_?#{#WOV;@4!DScCuqT@iIic
HR	}ɛr)R(
!SCcCuqTARst@9!uA	K@A7( 64@4!Ru@*us4@(4@)R(	h
	iS!Ku@_	ATOFWE#@{C#_@4*u@u@('7@4Ru@(7_@0u5@_#(^ztQ)u5t?#{WOAR
@b@9sAh
j
7`@`{`
7h@h
@"@
!(Qj
"OCWB@{Ĩ#p@	@9?qaT"@h	4
x"`ӱ~"@`qThRy"@?q
T)Rj@Hy)x")?
kT`
@!)"R5Rr"@qTi@*yvx*497yxVth
@yvi"@(kTb@96t@*
@*x1TCt@
q@T@4 Ryt@*OCWB@{Ĩ#_)Tib@97
i R5x?#{WOֺA@kTA*b@9 7t
@*wb@96RG~@
@*yh_T@@QIY(x@@47D'*h6
@*tOCWB@*{Ĩ#_A!<@*'t*o5?#{_WOA@?R[p*6RAX
@@@9qk***41T"@q!T
@
@t@*t*b@96@x1T
@))t@**3*z|@*x 4
@OCWB_A@{Ĩ#hOCWB_A{Ĩ#_
@t@@9h-h@6h?#C{og_WOW;@A@a@Ccs@{Ah@ 6!03Cch@6!>Cci@(@(5!	@9?qAT	@9?qT),@84Cc@4h@86p h*_!\*chc@9*h87v5.Rw54xvvqhc@9873X4w5_CRA@@	q5xxYv@@?5*@"Rchc@9(874@s	5@s 4	7@s5rق@|@r 5(kz84q`T4`59A!@w4@!@c 47ق@@A@os5@A@ks@4Z@@"R!`cACR)@]_|@CX"P@b|@@rh@86Zhhc@986@@_	TOHWG_FgEoD{CC#_ws*$cu@A@b)s5@(@9q!T*@@@b:}TrRr@.Bg9rq)."6g?#{g_WOPRRZrR&r@9_t4C!T@r@@i'ך?@
r7	s|4~@h(8@(!r8OEWD_CgB@{ƨ#_?#{og_WOZ;H@Ш9A8(c@907v4A	)@4)!\3j4XЪ7JI*+=>!+}rqh74!(1ur`4!t3pr5X9	JCѨ+;<~(@9*(9"'uh7Xor5r4%!T~527XCuX@9?q(%QTqiTkq^X|fHRd?q`TqT@8q%QTqcTKq`8(c@96XTrXw	4Uq@5q`TyqT71T(c@96X=rX*Hs*1 TKR*5s**jq4AX!@zq@=qaTX@)=J>IJ8 R'9:G`hRXqWi@hR?Aq`T?YqT	q!TXp;rX\%eH@_	aTO]W\_[gZoY{X#_֡X0e@
@qT!@qT@
!@qAT@
@qTtHp)e?#C{_WOCX;@*"R|@sA*R*f@*}
q*+T5QhJh8)qK(84@8e@@	!TODWC_B{AC#_{p?#{sA)R!#h@`
@i9nh@94@{¨#_@@R{¨#ջ{?#{*A*@!A$a**5sAh@9!Aq%->{h@9@{¨#_?#{O89S;h@oJk>+=#>~Ѓcp#=ACR*ph@_	TOQ{P#_p_$u?#{_WOCW;@A"@@I56	}C33@7.Rs
4b@9H7
@@`*}(R @p*4 @p49@qo5@*6*9@h7!@*3(@`To@A@@d`@	@u4P*@@@	ATOEWD_C@{A#_ր.7usldo?#{O*xuеA@4(67#R`u4OB@{è#d6lnzSb@907*q1`T!R*q5b@96*\z*OB@{è#մob@97OB@{è#_OB@{è#Gz?#C{og_WOS;h@ДAo@R
@AR*+r"@еAqT@2!T|ARu-*c8cR*LoqcT@9qT%Qq(T	@8?q)%QT?qcTt@H8)o@*o`k:(@_TZ#445o@5n$Ky o3Ac@'Rt@"o+@Rx6@v"	A	QIo1@8!8*_qo`4!3o`4!o4UQ@|o5z*qTuo`4{WB!TL@RAR*7BrA**cARqRa&R*}C@"Rc*#
)(@@9q&R!}*n@}
@%2Do`4$?o`$5sARR@(RRy6A"@94hJT[+	@8c?qo+@(}@4?	qT[@i8	qןq?k`Th!T@95@yqTRRn@$Rph>RZA)r9A%ۚ@_q 
T
 @h/HT*	qhC	T@.Rn}K	}@)
h@*HBAAR{3@*n*.y*Jn6HRy3@n4@AR@***?}7@K	(!	Z#RG@G*0}*h>Rr%ۚH74@a"R&}@y_q@)
i	*y"R}6@6@n@Qo!R@CRR[&xA3cA"R@*|[@@ZAqT9AR23@B`[x(@3cA"R*|[@T3@qT*"On 4@wH@[@֢kT3@m!Ayp@_	TOTWS_RgQoP{OC#_c!R@3xbTb!@XRbB!@7bIb!@9b@,5Ab8m?#{O89S;i@o	k>/='>~CѠ=AR*mh@_	TOQ{P#_
m?#C{_WOCW;@*o8<(RR=)m@9C#~n5@	@?k T@{nx?a@>R
R*qB
RI	m@on5
qR	R"d@_	TOHWG_F{EC#_ֻl?#{og_WOZ;H@*oR`v9Aa"R @n`6bxU5:6{Ahc@96 @ѡ"RnC]r$m(@*a#R*nC]	R
	ZqHZZ(K@z(mR!KRm @$RsBхnhc@97]x)!	l@
kTkAAT(@&Kw]xqTXEwѷI:>ju8ju8=mAT @ѡ"R~6ni)A@95AaTDAq@Th@7]xЪ)i*J!>)qk%I	qbxRv95R34qT
@jT3@`@n4@x]x@h4kaTC]qvsB!T@R,w@{A!Tn;ARq
Aѷ[RcS!oscC#wl
7qTCwl4Rq`NR9Kkh8@+8Tk4I	[8	T@RqqT@RR?m*5)6@K*J7J.
J!?
kAT{hTA	a@9@	7R*Rv@9<(*KvZo4l@9A{Ahc@97R:v4!Ryk"?6R!hZj`T(v@>SA1!v @!$RCm`7]*.v @ѡ#R7m7]5!R*v\ @A(R(m]qwZ6Rr6}@C&Ӛ7j8{h{huRusJaT@RFv @.Rm5#^85]3^8h5^x4Ru#^84u^x?qTP>u]].u3^84< u@Rv@RvH@^	TOYWX_WgVoU{T#_րh7!_j?#{og_WOW;@{A)Rh@A
}R R@@5h}
}
ڟH	*J{+@	)qRB{*ph@*h 75i#@@*RJ?
kTp _i#@5*7*7*TRTR@ ARw@_	TOWWV_UgToS{R#_*4*(7@@!A****nni@ @7!@****nEnp(6@**R*Ep@5@hc@9H7RA#*>p@y2)qT@y!7 R	Z}SIoh#@4;o`4!RR5R*#*)p	7***z*ph#@(4hg@96*+j*xao@4*Fj**l**lhg@9 6*ARl_qkT*7j`@yu#@@****yn*,jhg@96rm\u5"R**Rz**o#@@"R***]nZ(^iD.^^&^?#{W	O
V;@o**<i"T
Ro(R R**y;m	)B)-Bq
R(*?@_	T*OJWI{H#_@^vi?#{O89S;h@oJk>+=#>~c=ACR*ih@_	TOQ{P#_Hi?#{A@Hgs3E^?#{o
g_WOT;Ո@	)AR(
@kAiRwI|i	`T@7	)A
|(
@6o!Tc[SKC>=ivARnA)(
@J ~Ajc!&CѣcC#l,qATAx&6֢(CA9H6Z(4c@RRj
A)a@9r19c@H4B@RRj
A)=a@9r1:c@RRmj
R8*S@{i
jTji8Z8qTGA9):#9h6(R98/iAa@97F)3@CG)K@C/iCѣcC#l,qTiA@
@
| T)uJ@kI3(P6p7!3[A
@	|TDhiAЂЄ	@`.B/<K*\iA
@6(UiA
@P6*Ni@RsA
@ 7(7H06?ROA
@(86$7iA)
@J1vA+i97й#;)m3#<]%6!T#VuARm!HcC#ckq
TAзJR{7CR/@'@Hp/
6?T
JAJa@9_r	T+@_)aT+_%CT+??TJ*6?aT'	)A)a@9	7#R^D3@#@{h{ihAe@96A#@@"k@)9%!3hZ	)A
)@I)IJ)@	jZg@RrcC#ckqlTh@A9@_	TOQWP_OgNoM{L#_ր'A
@/62A
@h773Tg?#{og_WOCZ;	H@)A)@
l
4AB R*0^ RFa`	B0*$^Y*g1T*hgjg`{ALR*g4<`5!8/7`4@yldB>*]@f{j=g @R*=gAg*H@@	ATOFWE_DgCoB{A#_f?#{og_WOCH;/@RWg!TtARlR?lC~!1(~J
);(!:1# R*f R*fs7@;@oSc3CC!	KC_[Jg@qaTWRCCs!!_[:g(qTWRA	
@@65sB9KR_jT7	h5g@sAC*d
@@d
@*!,)Ww_4@	Q?1qcTR))YhR)At	@3K*GgA
@67@fW!4O_4@q@TqaT)7@bBp#W	]W@C@0#gA
@P6AC@@i@)9%!$-g@ROq?@Rk!(_3@4@сRB\Ѧ)!3@?@0g/@@_	ATCOEWD_CgBoA{ƨ#_e?#C{K_
WOX;@*oR**<qg`4A
@7oC#=6g5@
qR	R7y @ R**k`49@@e'g58
@9@yj
Z@}S99yk!>Lf4v@c>*kT@~@7i78hKRHr94c|*+*WRaeKKk((@BK\
hQ%)}q"*A\@_	TOLWK_JK@{HC#_֠&]Z6e?#C{O9:S;i@o	k>/='>~C*=Efh@_	TOP{OC#_	e?#{
og_WOCV;@o=:A@A87}	R
}RI@?Ti 65@h@7	R	AR		?!aTR7@R@d 
UR@!@7~@RTRj@5@7@!@RTRj 5j*4`%Y*
@**@**wh,@7@	
y@4k*!T(2)qTx4U@@y?kT@@^e@4Z@s@S*qRR!00Y@}Sh@AR#h@y`@HRqe1K%T@ARhK@(RsRR* hf@9(6@K@s!RRRh@h@K@s	qTBRR*!RRRhb@9A( 7
@#@@5iPe@69+i8Fe@"pAe6R79=e@}Ro
R[ 	R+?p6=+_*8"eZ[KqkT'E	T	+TA;LTh@@	R	q(9g@
yyKT
	!?qT*
)l%@x_
qJ	Q	!)k)5_	qT*K@#@!yh+@)A)
@+)}?!aTRo@UT;b
K@!R#h4cR**;i74/@/d
@+Fh?@)!;
3BT7;@	IT;/@9AACT+@(@5(@	q Tix@
}R?e
;z"R(@@9(@( 77@chh@y@0*d@1qTa?P'zd9A@RRn?9Q^*)@@^	TORWQ_PgOoN{M#_iX@@X`c@5q!TA
R@"RdWm/c34X?#{Aa@9sA 7h*@H`"@hp3da
ER`X6)?(})	ɚ)dh.@iFc:@"	Ț!d"@{¨#_?#{og_WO	W;@ւA8	@@juc4"bAT!W54@tjsc4sBATZARo**mRoc"R*=X$aTЕ>+C94Z^vA!TpcSfT@C8[4@*mC[4@"mc8fT@bc^qm^8qlm^8qgmbbc"R*W$T@	@AR|o*"q887HRhR8c"R*8m*n@_	ATOIWH_GgFoE{D#_=bL W?#{O89S;h@oJk>+=#>~ccP7=ACR*bh@_	TOQ{P#_b?#{WOA@p*`vR7ARroA)R*"AAR@("yA@0gQ*Aqb@97aRr*	aRr"R*5q*OCWB@{Ĩ#,q?#{sAh@H7h}aT(77@{¨#_RRh0+!Th@(6>!Th@h6@!@{¨#T?#{WOahB9*q@
Th@hSA*
c7!**a7ДAR*V*aq+TЉ@2@AJ(RRr
@L.r)
JjJ)
*4h 6!X/*7@h4) q*"xb@RH6!X3**@7@(gb*a
@[a*OCWB@{Ĩ#_ց!l*qTa*!`4
!*qT*!*7R|
6?#{OB9q T@@=aaSеA*
7c7!p*qlT@5飐Ri=r	|)+)e
@R)*
_qRJz(
̌R̬r)(}(
b
HRC4b*=a
@`*@ROB@{è#_?#C{WOCV;@R`AR*`B9*q 	T@(SA*
b@7
@`酎R)rR	
	y
ДA RZh@5Re@	!08*?8,@*!h*&@h@)(4BA+a
@R
BA*	*a@`
@`*@@	TODWC@{AC#_r`?#{OCU;ը@*`7!Tma!p#jd`5Ua@@@	TOC@{A#_I`?#{HAEAA7\A!%	@{#Z?#{og_WOH;@ֺARC
sA*am
4A**qkT*c@97h	B9@{#^3k	*T{K*`h83Y@)#)
kT!hB9?qTW1C@T@"z#q7KT*aA@Cb 5(#(
*hB9)q`Tc@96!TaR*Cm5c@9H7;4@3K"`h8
Aa@96T3ѠR
@@?jATC_h4@Rk@@_	ATOGWF_EgDoC{B#_֮_?#{`A		@
@)		i)i@	T@@R{¨#j@{¨#_?#C{OT;Ո@еA
@@@(qS)R	Jl)A@**@h7#ANR!r*n@@I	)@@ORNRIOR!#*n*_@_	TOD@{BC#_T_?#C{g_WOY;(@ШZA@@@Hc@9rTo!TlДARe3#9_qATCRVC*Aa1TC* *f_4_@qTCzT!9YHc@9r`THRH9(@_	!TOHWG_FgE{DC#_^?#{
og_
WOW;@sA**oRZc!R*ST@q T@*@Ki_bT)kTi@nqş}pn8q}!
"њ!T
i@
TIAT5IqT}@	Ri	Ykih5hrQ9jQ9))rk%,(_rеA@@@9qTa@TL_@RjrI)%ۚ67Rhk!	Rik	6@u!'J_Rjr 4v4a!8B_4@bB@CR*cUAa@9(7CRjr`!1~@˪	)_89Q?q@T*!#vW@Rjr4AH%ۚ	6@	7RhkC!1_`4!'_4|CxK:RR(ch8H#jU@B T"hKC>ch8U@Z_# Th8ih(#
@9	@9@9&@9bBCRT@ b@9H7CF!)^4!$,^@5hQ9R	jT`!3b@9raT,@R.iCJ@_	!TOOWN_MgLoK{J#_AqkT@*CkRm_8Mi(8n@9qrMi(8T	k	TH]?#{WOA@U*@o^@qU4h@9H4OBWA{è#է^OBWA{è#_?#{OA
@@O^5_
@@OA{¨#_֗g?#{og_WOH;@ֶA@
@@9AZ8RZ7{Rsv	j*@	#)}@	T(@2Lӿy(u6(@A{|C*lT@@
I?zP^T*i@@@_	TOGWF_EgDoC{B#_֠\hR]?#{OA	@@AsEP@OA{¨#_?#{OA
@@N 4GO@6^@)1BJ5B~H?1T`Q\@SOB@{è#_?#{OS;h@),A =)	@
@=@_5`X	c4
@R9@0R
@@HNhh@_	TOC{B#_֬\?#C{_WOCW;@ֶA@(87
@*@ATJsA`@b1T)!J7rxCqhT	)a"YhAc?{su*b**b**]sAT9J	)@*RJh
?_	kTR	V
@1@HR*b|@*b|@T@)AS @*b5
@@HgB4a@t?[]`@b5a@@`%R]@@	TODWC_B{AC#_,\|3sQl8LQ`mQa@`/EQBQ_$`/2]?#{g_WO9AR;#@`(@@YS(#@	qT(@"@@9S(@1@@T(@95(R!RRqrT(@		@HsS(!Ț(S
WR7R`4*hł*:#R**$fQ}@*\qTHQqTI)8+ih8J	@֟$j48,HQqhTI)7+ih8J	@֟$jt8$j4$jt$j4x$jtx$j4$jt$(@R@[)! A{S\$OEWD_CgB@{ƨ#3atP?#{AAR4R	@@{hA	@a*[5@{¨#_`P?#{OsABRh
@@Rh@)R
R~}A)(t*a4t4u[@-qT(Rh9OA{¨#_րD kP_$A!P5	@U?#{og_WO@@9_qTH%QqT**&sAh
@h4@R|f
OEWD_CgBoA{ƨ#_*J_qT_%qT"Uq
ii86_qK%Q@TqT~@!T@RYfsAh
@59A(@kT(@h4@RJf?~@5jT{К{'-<*~@?jTji8_qTJ%Q_qT)?T	*j)8n](@)@*
qJ_	kT4
h4@R!f(@(4`@*[(@)@	k`[)@*}`))I5+@8j%Qq`T_q)T`kT?#{
og_
WO\;Ո@o=`@AfZqk*
@	@_@T+Rl!}@_T)l!}@_T	)		)yS	#@)A		B'D	>'@:+@6/@2'D/@	
,'@/@ '3@#'F	7@9e@_	ATOOWN_MgLoK{J#_5Z?#{OAA@a@9!}(7@#(Ț*Y
@"Z
OB@{è#_?#{O89S;h@oJk>+=#>~c+=#>~cc=ACR*TYh@_	TOQ{P#_֨X?#C{WOU;ը@o>ֶA=@((7H 7!A`88RR Aa!$HY4R*@7)A @` e@*7!Rr*g*Hj@>)R	T\59B)=Bq(?֠
@777ABRYc.ARr*#g'AB)@JEB	}IJ@(	E	iH!	AB)#@@	}I(	E	j4Q5^R}
((b@9rTѡCѿC\5*d@_	TOHWG{FC#_X$")M8)Yq M'M?#{og_WOY;(@ֶA@77"@C)y?qT
@}RR @ThRO"@
qT
@R@O
@R	@OkT,****A*d*.6Zy{*93 {758*b*BkkTk,TaR**Y1T3**1T*b
X
W@Aq!	T,|bZ_CqT@RX߆q*CT*W@+"@H59!6J#"@qT
@@"OC!A`0}Xwt-+C	@	mXBT(@_	TOGWF_EgDoC{B#_րfL?W`DL`5AL>L`;L?#C{WOCW;@R')@a!0WqT@cIWōR)rR	
	yARTfWARRV@9cAhiq0):@J4`"$$0X*@R@@	TODWC@{AC#_V?#{OC	
_S;i@o)A>)a@9I6h@_	TOR{Q#_	k'>#)'=)A~C @=)W RR`5-KV?#{O***A*c*4~@**e*OB@{è#_?#{OT;Ո@o(R9HRC9RcyX1TC@9*h@_	TOE{D#_kV?#{og_WOH;@A
@@N
@R@Nt"**Ch@R**hR*@l8XAvx65RR`8*&aB3*1TC_*>W(Q?qyq(j58BT2WCT*gV@@_	TOGWF_EgDoC{B#_`P(KV?#C{WOCV;@A
@@M
@R@M
@R	@M"***@R**hR)**>1@T@`'V*V@@	aTODWC@{AC#_`PJU?#C{+_WOW;@A@@]M@R@VM@R	@OM@	#o
	_cyUAT@9#@?qTqAT@IRR
@5MC9'?qTqAT@iRR
@(M#y?qTqTqTCR9@@R

@M# k68	?TC9`'***n@R**hRCR*99d*U@_	TOHWG_F+@{DC#_`xJ-UtJ(/J?#{OCT;Ո@*A*6bR*od*fU@@@	TOB{A#_U?#C{O9:S;h@oJk>+=#>~Bt=ACR[Wh@_	TOP{OC#_T?#{+g_WO	V;@A)Ҩo
@@V1T"@Q"@3t(9RART@9*y4~L1TA@8(#*!5R@*V`6J@a@aRc^@)B|@*J@qk	TAxyuR/9(H@AkTJ@j4+RJ%J6+8=T*K@9J@@?9	@9?qaT@94
@ICyiICH@q`H@9(86"@	Q	q"T@A@Z@Z;iK	<qlT
@JH@CC"yjq9_RTbT@qaT#!RU7@5CT@yq9@_	TOIWH_GgF+@{D#_A_8`$I@IT?#{_WOCW;@A@@Va@*@HAuV>R
Y@@S	?T@R@YRX@	@9#BA "R**xY44S@qaT@a!8%@Tq`M@cA 
R]Y5@@	TOEWD_C@{A#_@`@HS?#{OA@sAbh"@4h@TR!R8Y8M)0!yhOA{¨#Չ^@
@R!R#5*'Y1aThb@96@OA{¨#_`
@OA{¨#_HTH?#{_WOA
@@J"AqTR!R*X1@T8MA1@yc
ODWC_B@1{Ũ#E^
@9C1
zx!{uT4
!TqT`TR@J
@@@4*R!R*X1`TODWC_B@{Ũ#_`(IHTFH?#{	SOCT;Ո@sAAi`@)
)@iIR)h
i`o`=@`
=6IR	h 7IR	@T"@5`@!	(F	"@qT
@@35@_	TOKS@{I#_~`T
@@"@H4s	qT
@@ !@R Gi(R)$J7BH`5G?#{g_WOZAA@_*A@T*`P1ART*1TAR*T7C@**RA*R#{AR*yR1TR*T 4R@qTAIR
@	AT 6TTH@(h@I@	Th@I@	AT9A(@~@T~耉R)R!**hT4G*^*^*OEWD_CgB@{ƨ#_֔!R_R**LT4?RVOR@AqT RbB`dc]a@]a#@`]@Rm]`cR\R@+=#>~Ѓ=Ac5C*YRh@_	TOQ{P#_֭Q?#{	W
OCU;ը@ШֶA
@@tso8V4
@@hF@
@qTb@9 7
@@D
@@N
@	!
@ @X!D@_	TOKWJ{I#_jQ?#{OB94@R\*@@
@qaTh@ChB9qTAa@96hB@
@qTAa@96B 4(54\NQRJQ*OA{¨#_?#{kWOV;@o<Q@4RDS1 	TеA*@6Rсr*=)S 5C^d	[@h6!Rr*S7\1[*`7b@9(7Щ]!AJ2K_	`TK@9R+h(8QJaT!?h(8[:@
@qT!@q@TPR*o]@5E+E$@@ [T(R19']b__	TAh7[^[@*	6@[@R[*@]@_	TOOWNk@{L#_֗P?#{O)A(	@@JA+R!2
@9q`TqTqT
@8M4ρ_8-kTυAH_N	@
M	ρ_8-kTυA<_N
@
M

@85@K)
@8m4ρ_8-kTυA)_N@
MA@+`ӫA@+`ӫK)@4M1A
NEM1AT5)a@9?rT!sB'nC@OA{¨#_րСxE`3E0E#oE`*Eh'E?#{_WOV;@A@A4hB@
@q T!@qT)@qTAa@9h7LBR$R1@T**A*(
a#* 7*@(4@@O	$DO*{\ Rd@&AjB@	)J
)+o_@q8ThB@
@q`T!@qTARcr*Q6ORA)!2*__`T*_8
8*AJ9BA`DAc@96HRr2S*Q6@`wDc@96Rcr*3Q
@'5Rcr*Q4'@!_DO*\c@9h7*hB@
@qyS@_	TOGWF_E{D#_mO?#{(@
@q`T!@qT!Rr{#{QOR	{#_?#{g_WO`Ё8)!T\A! ;ZAR.U`ДAUеV>֢	UUUU-OQIh8)?qaT}@_k(8ZRUODWC_BgA{Ũ#cP`ah7!8).D_$ՠ!98B?#{og_WOS;h@ R*!O@A*JO1TOZA*9Hc@96A!9 R*LO9еA@C!.R9}RH@D?j**x9#O1`T**3\Q
N*i;8O!@{'*OH@I) }@J-@&JO@94H@iJ)qJ%-}SQO@RY@R*N@*h@_	ATOYWX_WgVoU{T#_}N_$Հ4!A?#{g_WOY;(@C@hB9qT@IAa!TQ ARATAvw*r))3O5CO53#O@4ZR"T`_qTC_A)@`)EOO9N*@R(@_	!TOFWE_DgC{B#_N?#{O89S;h@oJk>+=#>~Cc9=ACR*Nh@_	TOQ{P#_M?#{og_WOCH;@@lA
@@Xb@9(6AA!8%@N 4[@*xX1X*
@@\\*HZA*o=Rѫ8>=<;)
I@8k,%Q?q@TqT4?qT)?qT(%QqT	@858AТSѣcѤCѥCѦsѧ!588FNV8pGE1T(!8`V[8(*J4C7\V8`*BQ+=#>~bBl=ACRPOh@_	TOP{OC#_L?#{_WOAAR	@@Y*R}Q*FAh~@Ț)RQR**w~`өZ)7Z2>LA@rRQA@R*W`**!Za!(BR*W*P@r9iq)*)}J2}	)LOCWB_Ahe{Ĩ#ՕM?#{O89S;h@oJk>+=#>~Cc$=ACR*Lh@_	TOQ{P#_ML?#{_WOA@@79A(#@qKTStVs6)R.&)@ yh>E(@	@yi@V#P?#@5(@	@yi@#L@)#	+TODWC_B@{Ũ#_?#{og_WO*!N1 T*ME|@"R#R*?V*=LTA*"	!@~`Ӛ*)	!mA#:{{?T|@A[RWT{7aTOEWD_CgBoA{ƨ#cQOEWD_CgBoA{ƨ#A?#{D=`4hB@
!@qTA)A	@)
@	yi*ih8_qT_}q@TJ4kkB9
kkB9}qTkkB9q`T_kaT5hB(A!6QL4@R@{¨#_=qK R?#{OA@(5L4OA{¨#_bKRK`RKV@9GVAOA
@@HR{¨#ՠV?#{O89S;h@oJk>+=#>~c=ACR*Kh@_	TOQ{P#_K?#C{_WOCU;ը@Ao
@@@O`4p@@b@9
6@qT7@*fR***@(9@qT`34(/U}X+@'Hb@9?
	
977
@J	q!@)7`BK*+=#>~cc=ACR*~Jh@_	TOQ{P#_I?#{g_WOֶA@@@9qaT`(P>l>_$s?#{ObB\**!RTV!A~@*hT*OA{¨#U_$A!	@C?#{KR*?#C{og	_
WOH;@ֶA
@@ sA97?@@*>hm<=B`~@x=_@1*S_H@*H$$a!TK@@	T`RR9SCѡc/]LT*_AТѣ!kI_qAT/j@9		@9?qI)%':_qaTRh9})@R
HJ#3R8{+I(c@9(6_=!d2BIqT_a!;IqT_A!4IqKT_uHqkTK]C@,rI]@'C*@(#@H_/@ii8mqHy#7S_QHCѡc/K,T
~@<0(@h7A(7HR@*!:IҨRh"SHR@*!(IA@`0*#I@R`S[I@u@@@_	ATOLWK_JgIoH{GC#_G?#C{O9:S;h@oJk>+=#>~bBP=ACRFJh@_	TOP{OC#_G?#{O89S;h@oJk>+=#>~c/=ACR*DHh@_	TOQ{P#_֘G?#{og_WOAIRT"A" @9A3@G(@@6|@*)*<}@!@!oG@5ju8qT*bR{V@*@5(R9@h@@OEWD_CgBoA{ƨ#_?#{WOA
@@@sAt!7R4pH*RG5_G@G9_*R@OCWB@{Ĩ#_?#{O89S;h@oJk>+=#>~c2=ACR*Gh@_	TOQ{P#_F_$A!9	@A_$@@A(	hh8?)qT)h(8_?*THA		+@9L@9K8,8aT*R?#{OA
@@IFq+TQtA!6G@59@	PR
R@
R@I*
"RLOB@{è#_`:;?#{_W	O
V;@o+=A@H7A
@H7(7!A 88R@AA!$IG!!A@|RU`G@_	TOJWI_H{G#_i)"
64R7*7
4R@H6HЉ$)Aq`!@5QQ@ha	c@96`lFQ@ARiS*J!Rr*U*Xc@9(6@c
L@@!+Q@CL`#Q
@a!F
4!!9F`4@7(6'A@)	5T6#K`$Q9B)=BAq#( ?@R(R r* 9XUKVA#K`P@R@
@A!@F4A!4F 4a! F
4@|!RR
@*E*QYARr* (U`9H4 H	#K`PEARr* URr* 9
U6@@)
57@P+c@96(Pt$R*~F ATc@9h7@@@P5/6HcѨ> Q .:Ehim$)=6q@!	:`:/:`0)x:?#{g_WO)A(	@@t)
@JIBkMBQBUBA?}S!ys9@A ?ր4_$:@@JE*@?5ODWC_BgA{Ũ#_?#{A	@@K5{#_@J:?#{sARj&AkA,k@@@}?
*J2K5@{¨#_h
@@`@-:?#{_WOV;@A	
@i7	@@7@!`@x@2!" 8rH)	a!T=R#CHT8T~*7R@ѩ@8?q*%QT_qcT?qT	*"ɚ?`T#CmHATA	*@9_qTJ%Q_qT?9@(	*@9_qTJ%Q_qT@!T)*@9_qTJ%Q_qT?9@H@)*@9_qTJ%Q_qT(@8q%QTqcT|@D*9E@_	TOEWD_C{B#_lD 99?#{O5	4hB@
@qaT@RH6i>*@8*4h.RJ_qAT	8
@8j5A@87@96O@	R	T@/O=DT	
_8_qTJ%Q_qT?8T@(7@9O@(*	R	T@RuOb)D'D*OB@{è#_?#{RD@8{#_?#{WOa6RdN
@9*4RJ_qAT	8
@8j5V4!RF@7*C*O*|PAa@9 7RG4`A
@6OBWA@|*{è#q8!"6OBWA{è#C?#{C@	qTAa@907@`<{¨#S8@`{¨#v8@{¨#__$ըA!0	@S>?#{O@AFsAh@T9F@oN
@CCh@OB@{è#_?#{	W
OCV;@oC=H#HAb@9h7#D@)R}IklEKi}I),)E)l^3
*L<*ʹ,
}LiU}JjJIUJKI}I+)Bӌb@9)R4	M	7@)@`Nu4Hi$)7q"X*N4`**N2@#(rDsAbB\RpDWN5$RHr~Q`?qKI}SJk(KJ$k7b1qdqfq h :**M@*C B:B$*CAm@ga~!a~Ba~ c!cBcL'C@_	TOKWJ{I#_B?#{OS;h@A
@@(HhHhc|H	HRRrhH
}R		)}
#Cq9h@_	TOC{B#_֛B?#{sA!B3B@{¨#E?#C{+_WOV;@o@RA=!R
@*@!Fa*o!=?C`4
@R@~hLa!34C4!!6/C4!*C@4a!2%C`4! C5
@IR=
@;@{yC49?ATktD"T
@@p)@:7Ra0R*Q5
@	@R9(R
@R	@"R@qT !M
@iR	@9
@
@R9kya0R*WQ
@ h"@L@_	!TOHWG_F+@{DC#_A*N@\	7?#{og_WOU;ը@)RRKFC(R*JAДA"@H4
@@y9"@	q*+T	@!R@o9Q*'qh~@y35*~@9K0s"R#4x4*tGK@qT
Q	((5Aa@97 RC4#IK@d
D69ajv8 BABT@RLC
R%R7 %OA<yw
hT@9qATmAP9A3!LBqTO{#^ATQA@C	RH!		%@
@)	%@)
	B1GI	)
		
=7@4@#ДA R'mP@@8qTa!A*q	Zi	[iqJT	T**A(	iy8(zicT	{iB		R)%ٚ	7)w?!TC I 	RIl	
T(+T#@I)"	Țhjy8?\K	K}
A9?CT@R3L7@'@@yk7	
9K07@@_	ATOEWD_CgBoA{ƨ#_tД7`55@?#{og_	W
O!?@?AC3ZAiRIrH@	})*)f#
	}Re	qhR4Rr|cIR	5RrIR|*Q(qecӣT|JcJ	4AbB	Rw7{Ah@@u@6R*w@Zv7H**JеACBh@B4@74R&-O7h@ Yt@"R7R!2 RrK[yKyP***XA
THsTJhc@97DCE.@Q(h8)qT|@?k 8C]K?qT@K*C?kRIR 13AC]4]
Qk胊 \KqT J*\R@@qkT!RC@@qkTRC@_qKTI@@qKTE@i#Aoc@SK@4R@+3@qbKHz&RDO@y6*~Hq TQ	2iq(1q`TO@y( 74_@yh7h
@R@_@yh
`43@J 8kT|@C]?	kTk*TA!K@5qAC]?kT3@*k#T+]	?T	@9?mqT	@9oqT+Q	qHT3@kT+qTR@**@#qTy49Q	'qTC])2*Q_k3@kT@7I?#{OCT;Ո@D@*	=Sr((4еA@6Ry@@7A		@	kaT		@	kAT@@	TOC@{A#_A?@@;W@H@A_$HQqbT*__lqT_qjT*LA?#{og_WOCA	@@лZ[B{_BV*+
@eB)aBs4?`T`3`I?T
?kT>hZ"TEI>+T7IchBRC(c@97 `6?+TA|{x@?5b@9rT`?`T3I`?T>(c@9h7`l6?A 9?A>ATb@9h7@RI>@Z[B{_B@WOFWE_DgCoB{A#_?#{ORHAaA<=R<=}D΍hͭ
	R"yOB@{è#_?#{_WOV;@sACh"A4yӘHh"@CqTh
@@Kh"@4R	qTRh
@@yt!Kh"@kTC@3s@3.@#BR=@qT	@94?qTK2*13ц. @`p7!
+1@!0A@_	TOEWD_C{B#_=?#{@(LC4a*@R@{¨#_?#{_WOW;@o**<:)%AR7 ARR=`<!R"R8qT[^^xJ)R	*4[ZÙ	5ZBdcѡ@LTZ\=>C]sACc\;RRx= =H+=#>~ccH	=ACR*=h@_	TOQ{P#_i<?#{_WOX;@a!7#c9RRW@ACc6d&@AccX0RRsA!T>a!C3=@qaT@RRKRrqIrhh9@c`c"RRTo=@AccRRI!Ah@A.K``(<@<!A`6F`@_	TOEWD_C{B#_;?#C{	_
WOCX;	@ow<5@
@Q}S-qhT	):+ih8J	@֟$(Rr"$C`
c)ARBR*$hRH
r$Ո)Rir$hRH
r
$HRh	r	$HRr$hRhlr9h"2@q
Tba9@7 е;RR@'RRy RRs 2RRm@?RBRg`RBRa 6c**Z@l	c**S(Rb!9A
@Cц>\@T_
@	T
@@[@``

BRvA2@qaT@@2@q@T*v2B**BC*c RR*u"@q`T@qT@#`c<RRj@#`2cRRb@hR@_	TOLWK_J{IC#_;?#{WOW;@*A!T*=`C#>C#>kT@**`?C#>T@;E<@_	TOEWD@{B#_:?#{{WOV;@**o?q<><'GTA!3C#;q
T!!(C!~!1(~*!)1#!3C/7+u;0qTA!@R*Y<CR*T<qTG@1qcT*GJ?I)EYhiH)2	q:EIj)I6J0qI)K@ikI3)1q!)E@_	TOQWP{@{N#_e:?#C{OU;ը@!!C3 ;qT@A!)B`2@9))%q H?@_	TOD@{BC#_8:?#{OT;Ո@A!#3#C:q+T@a!C_UqT)! yh :?`@_	TOC{B#_
:?#{ORrDAAM=
BR^@OB@{è#_?#{og_WOT;Ո@{Ah#@v@q-TA@:c0R*c:c"?RBD`a
D@@hc@987@A8)!T!G#zqkT5R@R99!R9#hqT;h3@y	(R	j`
T@	TДVR@@@Hh@ @FcMqkT@AR99<R9@9*B>5X9hc@9h 6;*9c*qT:4Z@z |+q.i@*}FJIJ65i769@
RR>h@4 t'}.@ RCԎ@78*#(O95~@C@9H4qTRF9`K+0Ԏ@t@@s236RK,`1RF,@
3UsJ223Z*@GH4E,H4@,@v@
TUVf@@G VFcqKT@AR8 9*@6ic@9?rT	2	h6C(8cqlT#HQeCR.C@@	@94C>@9h4RC@R&C`	:Z@@ STs	T@85ȎB;@*hc@9 6
@9x@76hc@9r`T8@h@ 6;h@h6@9h7@`hc@9 6@X%:@@_	ATOEWD_CgBoA{ƨ#_h8@,*-?#{O*!!6p1@9z8@
R*=@OB@{è#_?#{_WOV;@cC;T@@9qTA8@>85	hh8?)q7hx8qqATC#;MT@T@B@_H8@	hh8?)q78*
@h78@B`@
8_@
8*@_	!T*OFWE_D{C#_7?#{_WOCU;ը@*# R*#8#<#@9H4**R)iS)(Jj8J56A	@@#
@84@XrTR'B#IB
RB		@		@_	ATOUWT_S@{Q#_֞7?#{O!RAR
@	aTi@9	7 6 t8h@tA2h"@RAHA!R`
@l75(R 7OB@{è#_OB@`0{è#z8?#{og_WOW;@=(@4hB@
@qT!@qaT)A!T: CqTU@@9(4A=Bj3`T=s" 5737CqlT}]7^7hA	!(74!!27@
4A!7
4A!%7
4!!;7`4a!|74Aa@9H/7@@+c R*7cHA@:S@c*a
@;5;R0Ah@h@`6yh)A(HQ(!R@72)A(H(Z@Z!R@7!03)!R@2|@R7@6*@_	ATOYWX_WgVoU{T#_։6?#{og_WOCA	@9@7(7a
@OFWE_DgCoB{A@#+ 6a
@@d37@`@07@	hA65RV>`@hc6!Re@	07:@??@
T(7)@9I7f6C*RI;<6	?hTRD;R@;R7;*6	@T "R**;4h@q!T*l/|@o@A*C*B 
R*;*-(@9h7*? @R4U4DA	Dz@(6 6hI_-) 6 6@065(@*y*qBb@9( 6`@N6@T
6v@5u4FqT(@_6V>2(`@ OFWE_DgCoB{A#_!@OFWE_DgCoB{A #Հ*!@OFWE_DgCoB{A`l#s*?#{O R?M3	hh8?qT)4?qaTRij(8TJ(8OA{¨#_?#{Os5|@n5	?"B$-X,OB@{è#_?#Cs{og_WOT;Ո@	Ro R
R'5)b7@4@A$!T7;A&k7@D)H	 R=[C*h
cxj7#0AW*3@@#C5A!T7  9)YA@cѡS
=Z	#@Q?	qT@
6tR*;1T#@***HbqT4;b(hgax!!	*qTcѡS(5C)'=I#>A~C@=u4	5:Q	2iq41@65@#R*3uVWеf6#44:Q	2iq414R*34@_	AT*OTWS_R@{PC#_3?#{og_WOV;@A]R
R@		v	

xi

~)
%
I_R	ꠓT@@A3[URs9{%*ɨr*5o1 T*i4 4@`(>@\(<S@!@
!@qT"R#R*=@o
[3

	?=T@kT@(
@@8@@ p'*3@/(@9	QJ(@9
QI	*)?qNT)@9?qaTnBsB	q CAR?N@7 KAR	q?N@ SR	q?&I)9c#uS?	q*?&I)9;+uS?	q*?&I)9;uS?	q*?N@9;R	q?N@ AR	q?N@ AR	q?N@(#
<AR?	qZ ?N@/ +AR	q?N@(3
<AR?	qV ?N@(;
<AR?	qR ?#@	qT@@3A7@Ra@9)=O/@*=)?)H86@`,=h?3/5@3U[R
@>biv83BTJ@@%qR3N@I)4@	q7!63 5
@@94еf!"RB z)@`%A!d@X3
@@X7!@93O@h +3*4@$|3 ;#@x3 L+@t3@@D1p3@ l3@@h33@ d,d3Z@@(4`3k@#\3V@ 
X3R@@82T3g@ 	P3@"CA?T@@7&[5R{%*ɨr@R5Rɨr?	T@@,&[{%5??r"Tg@*[{%4#B
qT
@#A'A	"J@@)qS3)!g(6R@487@(3g@!"DE&)!*B7Ơ23@@2&5* @`4R@qKT**43A	Q%qTkA:jih8)	
 ֟$$@A!&2`4!!+2@5
$sU@$		R1C	R15R$c@96Lь@"k}@_`Tih8*81T@3AJaIih?kTAaT9""RB (H@7AT#V;A@g@@*'25RR@{kT	@46 3	@06@R@1@C@031@RS; +@L1/@5;#T 4@h i2еA@X6	b@[R{%ɨr6CY@h(6R@qT***`43AqT@@l0UU8RR@kT*k@45**n4@qaT@@ 309k@kTAc@9	6@@	4@7
@@0;0@Y0bTRak|8H	r7)U>@"t0;qKTTR{ɨr*R`B
*B70{C6V4Rh@8	Q?}q10q!T@R:CT@Rw07@A[{%c@95*h'6@4~4@
@[U 8<]0kT(R!@9)Q?yqT!#T*J0T@9QyqTH0@R~:*T6@,%1@R:0A@_	TOEWD_CgBoA{ƨ#_@$7P$/?#{*)!*ih_kTAAaTs!"B R%(@@{¨#_?#{g_WOA*S@kT@	@
W@		L}6
T8*/*ODWC_BgA{Ũ#_O@К9oBZsB	qRH?O@R	qH?ր'I)"uS?	qH*?ր
'I)7uS?	qH*?ր'I)7uS?	qH*?ր'I)7uS?	qH*?րO@7R	qH?րO@R	qH?ր
'I)"uS?	qH*?ր'I)7uS?	qH?ր@
B?T <*z/	CT?	T	@)A5"
#@_A5T
@H?T L,(:" R~?#{_WOA*l~@
@*CZ		
u%˿T p*J/N@oB9sB	qR(?ր"I)R	q(?ֵ"v4&I)uS?	q(*?ր&I)6uS?	q(*?ր
&I)6uS?	q(*?ր&I)6uS?	q(*?ր&I)6uS?	q(*?ր&I)6uS?	q(?1|@N@R	q(?|@
N@R	q(?|@N@"R	q(?|@N@2R	q(?|@N@BR	q(?րN@RR	q(?|@@@@_bT R@*.*ODWC_B@{Ũ#_?#{*)!*ih_kTA
aTs""B R$(@@{¨#_?#{	o
g_W
OCH;@ֺA	R
@J@qRH	ȚH4
@@@R8J@"@@R@$q3p4=*q.qTnB{sBz*ќ!N@R	qh?J@H4I@9N@@AR/I@9	qh??&I)V#uS?	qh*?'A7I@)AuS)M@*?	qh?#:ֺAN@@R	qh?N@'@#R	qh?I3@9|@#N@/I7@9@;	qhAR??ZC@
@@)@		
@)A*?(4)1?rT)R	kT7>,W$	A?Bp##J@/@)qS9!jh?kTAaT{""RB #@)o)e>)R))=IRI)~Sijh?kTAaTF#"RB #h@?@#kh?kTAaT#"RB #@@D **#-@ֺAnB{sBkT@@_	ATONWM_LgKoJ{I#_o,?#{og_WOA@%TC%T
@ "t,!;Bn-
@b"T8-9N@nBrB	qR?N@R	q?N@"R	q?w@ TH@h T2 @**;-hQqTki:jih8)	
6R ֟$!5v,@5?qT?qT?qATARO@nB	qqB?։O@*+qJ:k'v?	qiR ?ֈO@"R	qh?ֈO@2R	qh@?@t9@*,$!!h-5, 5J"Iih?k	TAaTRs#$A!$ ,5Ja$Iih?k`TAAaTRs6$"B *"($!;, 5?qTARM@	qmB)qB(?@,_qT "@,66R#H@(@9qT9,*" *," -,4*@8,qT5 `*z,џ$ `*s,RZ4kw8qk,_k!T@R6A_h?I
@@u)u(HTOGWF_EgDoC{B#_OGWF_EgDoC{BH+#A,AOGWF@_EgDoC{B 8-#?#C{WOCV;@.+*-@A4R@qT**4"@+4R@kT@@\*@	@9R@5kT R@@	TODWC@{AC#_*?#{og_WOX;@o`AR<c@9	jT@@HQA@@@I R@ R7
(@	@8`@^o;?@5C3456Y*s5975~
}~;E3S+4O+@4K+@4G+`4!!+B+`4F3@!C#!=3+qT苀'=<#%+qCTP))}@hk78(NAT'9%*_!3R83R~s83Ryc8b+qT Rr!**0*0菀@8yz6!+*
4A!5*
4A!*4!!:*@
4!!,*4h!*iw*`
4BT!!*@4!
*A 4!!:*4!!* 4!!*4!5*4A! *@4!(*4!!*4!H&*4!!9*4A!*4zZ%@kw*4BAT R3r*r0 R3r*|3R**3R* Rp@Ii+!!(>_*`4!!Z*4!U*@4@9yqaT	@94	@9i4I*i)!*))	I	(E9!"C!Bc\A(!B%&''!B0	c$8
ư'A+R!B!-B|!!"Р!Bc
@9	Q
R?iqH1Q(}H	6(%'	A8(
'H	E(
'H	e5-'	-&H"%&'I5!4 Bh9cT |-' Rcx!,&Bp#D!
Bt cH5诂R3xH@>
@AR-+ѿѡтRG)5?@c@9H7?Ѫ!Rc@9h6 R]8@Rv*"*sj<	6Ij(E9IE@9?	kaTc@96qT**46AR!<-9R*}qTR-B#BРR!
qTR!-	R-B%*juBBT(R4 8\YbB`.R\YbB`1RC\CYbB 5Ry\YbB ;RsA?@	@4(x)y)@`L33URVREsB
jt8J?3N!T@^	TO[WZ_YgXoW{V#_ x>5(:+673@ /?#{sAh
@*W*5@{¨#_a@ =:?#{OCT;Ո@*AaR
@*5@y@y(	)
q @@	aTOC@{A#_֡@<'?#{WO*.xr=ւ:Zh.xr=Zh	
)<qJ
H)RjRIk*OBWA		 {è#H?#{)A)	@ yhl{#_?#{*):*yh_kT}aT )Aq)R) {#_?#{WOCU;ը@**ֺAaR
@)5t4yy
@R)5@@	TOCWB{A#_@<@ h'?#{O9:;T;Ջ@o)J>'=3>6	!!1T](]	!@@_	TOQ@{O#_/'?#{g_WOH)J+,
01 B$&})U
JY6kE=Ή&1'.!x&Bc%X&8:458YZ#(+)3J;
+C

.	P!#$E'Д,'rR!9;6ZG
).Je5k9,5}&.!B4 cH5ƀ
'S[ck'/7?X="`<9OWWV_UgT@{R#_?#{O	@8 R?q3a!`.* 5a!`1R* 5a! 5R* 5aР2! ;R*4OB@{è#_,.?#C{_WOC	
_V;@#o)J=';3<}sѠ>sAR(wA*@5
RQ.@4@9?)qT57@41h4_8)qaT*<&@(@_	TOTWS_R{QC#_@	kTV>5е:&?#C{O9:S;h@oJk>+=#>~BCR=p(h@_	TOP{OC#_%?#{g_WOhAa@9r7Zq+T:U***Z7{;%9&A)i4*
_kAT)
?kT@P
	

?kT@?qaF9BTx4OEWD_CgB@ 8{ƨ#7OEWD_CgB@{ƨ#_?#{WO_qT**6 _k&4BAT*@4i@((
h@(*5@i@((
 RhOCWB@{Ĩ#_ ?#{og_WOU;ը@v)RֶA
)@h7
@B@'@R@i+@`4)A'o    wA7@)@))@9?q6?qT@~"T@#AR"R*@
s(Q@T(R(R*"
@	R~@RR~@IRTRJRqBaR(@v4S!R"RR&v@S!RBRR&v@#RRR&y7v@@4@RAR"R(z7b@97@RaR"R@RAR"R(@zh6)@
@}HR @(R@'AR4)IB#o)X3svS*`RRhbRÉ<È<y+9/9)z@d"#R*Y& s7z@!RRRR& p7@4z@!RbRRI&6@f@906z@c"RR*<&o7z@~@/B](@@)4h6z@
@sB'AR@BR#Rof@9(7R@RAR*O8(j@9*h6* RR*hy(#**h5*$z@#Ry(v@/h7	2Hh6@#~I+e4z@#RR*%f5z@#R("@@LdT
@ I@P*P>@#!@ROO*qMaTz@#R(s&!`'@RR%
@"@+/f@9(6@x8%/@~@& /B@(C@?v@oC@@@@kVTx:A	}ҚZ}	z}RI}`Col*.
@+OT*(RG%@65hA
@(6@@H4B@@#!RR@z@R(yi%`Q7
O)R*@'%hA
@B@7R9Ay
Z)}Sy	Z}S
yy~@**}SF4
*%@xkq
TJQF*J	i6I@9		}S(!(AHR?(j	(Zy@
@(yz@#BRR*(%H7fO)9@R*@'T%?kaHT'+G~@
Zijt}SC@=I}I'*GII3=7@c@}Z
G
	Kh"!;7!R%;4*'57Ay#4{c@k@{ARs`w@RR}R_<*qT'@h@HRKJ
Kr7)4@9@9
qAT4	2?qT	;@9
@9}R?qJJ_Eq!T?qRRjk
kjkAk@_kT?q	R
R)	ki?kT
qTK#@q9TR@9uS	
~	[@9qTK@9-q`
TH@y	Z}S
K@9-qT{5*kR*R*
q*@TK5hL#@9AuS
@
~7+5kkAM@ykAyk	ZAKkATK@yC@
kT{R*1	K?k+TIG@9?EqTkkAI+)ilx@k@k	T
6!	K?kTIG@9?qaTkkAI3),@ykAyk	ZAKkAT)@yC@?kTJ74_@I4DCV_	kT87#"R*"#R#R*(4CV(  !R:ҚZz}R`Z4_@(4Ch@jH
)	hAa@9H87#"R*"#R#R*(5#~-@{&o@RR`<`:$$-p-hAa@987 4i-CR"}RhAG@e@9r)*(7@{&o@RR`<`$СQX>}RL-hRHr~f"D-
R:ҚZz$%qaT0-7-_q(RhT*:Ҍq<*ii8J	Zz@֟$x$ d$ %-'@$'@')R(R#0--4#-CV	*($--hAa@987 4,CR?"hRHr~f",hA
@(6#@9 ',hA
@H@6CV'C@9D@9*,?q	T:*k<jih8)	
Zz ֟$@-7$ :3$/$ 5+$@ (,&$ t
,)R(R#$#@9}RqT,$8$x$ d$ %$,'@}R'(RQ(R6,wA@G
@lT7@R,@H4'D)5?qKT
@A)T+D)5ШCV)I	k@T4
@*T@s몫T@@^	aTOEWD_CgBoA{ƨ#_*& 9|@ tx@ tV 8!qDn`M.hA!=d@>B ?  < 0W@ pSP?#{+OU;ը@o=)C"`5_(@@J!_"@_	aTOF+@{D#_ : ?#{OCT;Ո@u*)RA@(06!R"RR*s"7@H6!RRR*j"7@@	TOC@{A#_  /?#{#OT;Ո@u*oA&@!R"RR*@"4&@ @_	TOE#@{C#_֤ ?#C{O9:S;h@oJk>+=#>~B9CR="h@_	TOP{OC#_z ?#{WOR*h@@	AT#OBWA{è#_?#{OR*h@Hh@@h@@t@`OB@{è#__$4?#{WOvֺA**AR.@
.	**qT"R*	OBWA{è# R_?#{ssA`.@=
HR`.h
@ R{¨#_?#{OA4uеA**.@AR|
 T**sQ.5OB@ R{è#_?#{WOvֺA***.@
.***OBWA R{è#_?#{hA!@@
 R{#_?#{ssA`.@	`. 8W*a.@"R#R$R(h.h2@IRi
 R2h2@{¨#_?#{WOvֺAAR6@.@_8)qAT.@AR
. T
	>@	?)q?7( R!R>@.2@.22OCWB@ R{Ĩ#_?#{WOvֺA**.@Y	)qQ!RaT.@N	)qT2@22 R!R**OBWA R{è#_?#{WOwA**.@`	2@.@224v
"	>@	?)q?7 
˵q.T>@(
**OCWB@ R{Ĩ#_?#{_WOxA**/@-	3@234/@C
?@	?)q?7 ˔q/T**7/OCWB_A R{Ĩ#_?#{ssA`.@	h2@`. R2h2@{¨#_?#{_WOwA8|*8
4Ts"j	.@Q*.@R*.@.T*R*.R*.@ .*R*.@.T**R*wR*r.@9R.T9RR*f@5.@3sj	"c4R*VR*Q.@.T2@22ODWC_B@ R{Ũ#_?#{WO(|	qTQ!R4wA.@7 h	R+.@>@
)_	."T5"j		$R*R*R*.@>@
)_	.T2@22{OCWB@ R{Ĩ#_?#{OssAh@9t.@.06h>@h.%(|Q4ARqTq`.!T`.@`.Rh.@Th2@2h2OB@ R{è#_?#{ssA`*@h.@ R{¨#_?#{OssA)|h2@2h2I4h.@4Q`.)qTh.@h.qcTh.@hOA R{¨#_?#{O4|44uA.@Q>@	?)qi?7 ˠ.5OB@ R{è#_?#{OssA4|4`.@Q6`.5h2@2h2OA R{¨#_?#{ssA`*@h6@`.!RQ@ R{¨#_?#C{WOT;Ո@5|C4vֺA.@##@9)qT.@>@q
ğ
?	.T#qmT*3#*`4C_(5*(R.@>@!?
qT@_	TODWC{B RC#_,?#{ssA`*@Hh6@`.!R}Sl@ R{¨#_?#{_WO7|
4xA4s"j	/@Q*?@	/@?T*qaT /
T*)q@
TR**q`	TIR*/@	?@(/T*R`R*	/@
?@ I	/T*R/@	?@(/iT/@	?@(/(TrT*R*R**W5OCWB_A R{Ĩ#_?#{ssAAR`.@h.@Th2@	i.2h2@ R{¨#_?#{ssAA@9`.@@T`.@ R{¨#_?#{ssAA@9`.@@T`.@ R{¨#_?#{	hAIR R		{#_?#{g_WOCT;Ո@uA.@2@.@F@qv󢓚		
	@J@JhT_HT@
	TV.^
@_k@j
hT_T@	TF?T		@)@:"T;	T		@*@ZcT;@`T@-F@T@FT?T
@j	@)
	@	@	@)
	RL&@	j	@@	@		@)@))
		@"{F@.		K	@J@k@_	haT2@>(22@@	aTOFWE_DgC@{A R#_ּ?#{WOwA*6@f.@2@7..@f	T%@6@)	v&6f6@Ts8aT9OCWB@ R{Ĩ#_?#{og_WOCH;@R*hA#?ua@9A6@!T(R%&
R
R%&@RR%&@6f0QE!EEta`aO#yh_9AQ @h a!AR+!R**#8${{A.@AT*@AhTg.@*c*kT6@*hK	kTR2T*@i	K5ARhA	)}@)@?ThA	)	kT***AR8RC)*R2
.@AR*-*R2uAR)"@*)*K7&F)qjVZ*uS_IkiR*4R$#7q4T|***F$hR#l/;$ 68$.@;|@*@*/kT}@>@	?)qi?7(kkTZ@**+K$ 6$C*V
@*	qaT&@	@	4@>R*#'O:@	*(K!3k
T&@#*@'?y9AaK#"@7{{AA:@	#?kTK!C**+"@>R*KC*#@C**+*>R*&@/@C*@*tAKC@@*#*{{A*:@"@'KC*@/~@6@74&@#@*Yk?q6
*k!ThA7~@/F64;@s6(K	kTs;**y#qן**uKr#;uAq+T 6d#/@(@947@c*i:@)AQ"@cc>P*/@@94R&>@?()Ti)A~@/*/6@{Q?kT@7@*")6# 6-#
@	qTL'
@y{@9A{A'@4.@B)>@Rj|
E	Ě'RB@9kTR`B8
&@9@6@*9:@R6@`K"**" R#:1`T*"*1T1CT
@iqKT(4?qTk<jii8	
֟$ R!R$hAyR!6@Q6(4	qTqTqTqTqTq`Tq#T&@
@936 Kp`2qT6q Tq`Tnq/T2qT6qTq`TnqT&@@@+ R!RBjqMTqTfqTnqT9$~"qT*qAT&@@	@9?qT?q!*TN"q@T*qT&@	
@+HRHi)8&@@@&@@$ R!Rw$ R!R	$ R!R;$ R!R$ՠ.@2@.22&@	@?	q+#T
@)Q	_I)8&@@4@[7*c*w`4[@h5шqsTq@Tq`Tq`T
qTq!T*@>@)qh.@	7	
*)T._$&\hQyq(T&@
%@)?
kT@(}@&@&@	@)yS	&@	@@)8&@	@)	B~qlT&qT* 4&@?@
%@)J}@+k
kT@A&@&@	@)yS	&@	@@)&@	@)	?9!`4!4&4!!`RA*@.@*. R!R.@AR.HR
hQeqT@/(8A92qHR9TA9@9/cBRh@54i/@)A|@*%uA&@	@)K	!
2@)R9i)A5R(1@2(1@5)AivB߂Taiv4b"T(i)AA"-@@ @9*	?`5?!
p2@22&@)R
&@*@ta@	@cBRh@/@qq	*i)A?q(-iwx4bTuyA9A@AqTClA1@
	@	@?q)
*b1i7I@94i)A E)3-@?4uA62@@9a~@?y9A`5y9AaF@!BTB@!9P&@~@N&@L6@J `- @@_	ATCOEWD_CgBoA{ƨ#_%?#{OhA	@@*@1`T*l"R#R*_!*#*ZhA
E@J
l	@k@@
	aT	=OB@{è#_?#{O*A4z!tAb~@$R.@7.@F@3.		K	@J@k@_	haT2@>(22OA{¨#_H h(8H@h4 @9 9qT R@_		?qaTHR
	
?qaThRq!TRJIIJ4*hj8J_qT?kT R?H(8_*_*__?#{OS;i@tA>@).@(?TCq
T*3CG`4@H5.@.T>@.h@_	TOC{B#_l?#C{OU;ը@LC3`5@4CC34s@hCRY@_	!TOD@{BC#_<?#{OCU;ը@(@9%qTHA4R
@	qT*@**`@@	T*OC@{A#_?#{OCT;Ո@@@@i	ii8@@	TOB{A#_HA	E@			@_k@k
hT(T@	
_?#{SHA=@)T`AR
T`&@{¨#_?#{OCU;ը@*I@)A)E@`*7	@**}`k@mIj83kT_qJQLT@+@
	@J@JсT@@	TOC@{A#_։?#{OCU;ը@* I@)AK)E@}@`,	@@
)T@ij83k@TJ
HT@	!T@@	TOC@{A#_U?#{Ott8)qTOA{¨#_OA{¨#`?#{WOWAU.@A! >@cT"@T+"@T.OCWB@{Ĩ#p?#{WOCU;ը@VIֺAF@)A?9hARqT>@h@iT&@@
i	K+}@I)A_q4
	@@iT@Jqik8,8T
	@k@4@F@ATI?9@@	TOCWB{A#_?#{SsAh>@HTAR,Th>@ R@{¨#_?#{g_WOCZ;H@R*R[{AhG@7[58``@`ChG@
@)@)hT?T@	T#`#`GT`#R
@t#@	@
	@J@J	
	@	H@@	ATOFWE_DgC@{A#_F?#{og_WOC\;Ո@_q*@T@94***9>R
qT*@7@*?qTbRKkKTV*"R@9:RK?qT@*7KtqB:kT@9H5u@@	aT*OFWE_DgCoB{A#_?#{WOVֺA*_|q,T@4|*S***pK*&qT@t4V>QB5@**OBWA{è#_?#{OCT;Ո@J@JA	JE@
	@@BT.T@ik8k)q+T@)
T@@	TOB{A#_֊?#{OTA6@*@	q@T*i>@6@)qh	I	Q7
˿	k*#T.@IT.OB@{è#_?#{OSsAh6@	qT*`*@`*h6@`.	QkTOA{¨#_?#C{	SWOCU;ը@VֺAoF@HATBD	@R@A)
!HRH 7*
@*@[@F@!TA!B.B@!9**~T@Aq4R@_	TOLWKS@{IC#_?#{@	@4?qT
@
@@`
@@{¨#?#C{K_
WOU;ը@#6HA RVֶA5@@S"@sA4
@Q"!R hRu
YE"@	Qi`4
@Q"!R hRg
QhhCh@944.8s h@9h5+otCvz6*2T3CsZ*jy j99#?cT@R#qATbT@_	!TOLWK_JK@{HC#_c?#C{og_WOH;@B`"CRRR	KK?qIKB7C7	 B`0	h@w@	qTKiR)Ir	}))`)*}I}I)
	K	i@ ?qTi@R?rTR2R*

?jD	@z?q)Չ)8R[{A**Z-*4kTk!Thc@97HAi@@
@?
kTi@
@?
kT
@Qk**q !T9?qT@@_	aTOHWG_FgEoD{CC#_?#{OTДAU	o@)7@A
@	@9@@qTJARR`8
h@94u 
@
@9h4 
@@As@}qS@ OB@{è#_?#{WOUеA@@4w6B9(5B@
@qT~S27	VֺAR	j@)@z R**H4W4@’@c7@(@9qT@9	)8qc8C1Tb@97Ž@T@9**9OCWB@{Ĩ#_?#{SsA@h@A
`
@@!{¨#?#{g_WOXAA	@!A
)AJR*	BY@7WA 4 *a@8* ?Z*aTR*@6h@H74** ?H*v@	|
S)A&JQ@Jc@979#@4$-OEWD_CgB@@R{ƨ#(_$I)AJ(Yh!@J__$I)A(a@J(Yh!J_?#C{	_
WOCV;@WA	R@
|_
@RI	R
(I)A(	<

@@(4R&#o.4T5@fS@@`K	@@K	@?TJ@
*4@4Q
@@su@5h
@
@	T`@@5q	@s@3R*@4sQ@_	TOLWK_J{IC#_D?#{o	g
_WO
T;Ո@o>#Y9A*(c@97
@R@ZZAS@3ba@4s@sz@@9qT*`@
@(c@9S7ȎJV?;"q9%KLՂ_"q;R@O=VA	R3A<I(@~C	ɚj<T}D^Cvj<T@#}	TR)}
SA@#	Țh|?룃TcSA@#@Bx/@Ȃ@	'w4.@Ȇ@@T@_	ATOMWL_KgJoI{H#_֖?#{WOUеA
`zt2TOCWB@{Ĩ#_?#{WOWAJ0;

@bztTOCWB@@R{Ĩ#շ?#{OS;k@')2TДAHA
J
@
@		R		Rk_k,yJ7i
@Jy.k6{Ќi!
j?q5h(69H>@#!##"h@_	TOE{D#_?#{SsA`
4*~``

HA@!?	@{¨#ղ	?#{og_WOH;@HA@*C'@@94q;R|y;6qChT3qT`(_@	kTC@9q`TqaT@89*(5*	*|*@9*5@*X*@@_	TOGWF_EgDoC{B#_!?#{og_WOH;#@URA7[Z{AZA***֦
4*4K3CR*qTc@*"R@8!
TQ41@T1`T9@9?'qTH@	qBT4H@@a@*1T?#q@zZ?+qaT**kBTI@)3*@JkTsk)HTRK))	
*R*&kT@R6@@@_	TOGWF_EgDoC{B#_H97_$HA)R	9_?#C{og_WO[;h@Y9A(@@ SsA!
h@kJT`@@5@@#;%9!'o(c@9*H7v@
Kc7K4(@IHB)A(?4
@?*1TA!AoR*   =(
4_qTРC!
4TA@9@9HImB)qB
qBAR:@?(Q
q7Tk=jyhx)	
 ֟$l
s@)c@9
I7	2?@qT@@q	,)4@**BH**9_@Q}S-qTk<jih8)	
> ֟$3Q$\9Mh

_#qTC!5{	4.<4*
>_qcT**C!,k.4HA@9*94Rr}cHR(y$K@hh
$B
q7)B0
@A$W@k$$_sq_wqCTC!
'4[RZ:[6qTРC!6 4'@o[6	1(><!>	$@9?hT#yi)]9R4-[R([	1@9!@97?q)%*9***_q*/TC!\9`%447Y9A;%T_GqTРC!'5РC!-e4[AR[AR	H:*9s6$$t;$>
I)AqR(R@?րx6<
}
'z
qT;u
6R
qT
n
VR*h
*q;%T-
qT[
4R /*U
*HAARI@?
9J
Q?q9h
TT
6a@"R#R*`
T3+#[{A(uSARv@?AR@?(wSi q*@?/AR@?AR@?(sSh*@?4R2('kA
Ta@"R#R*L/@9KYY9A Th@T	
)}@?T#@;%Y(XY9A(`Y9AK_+qTC!
4I)AVR ;(@9)@9%Y9A;%94R>r}c(=8_'qT*РC!@4[AR	[AR[AR	Qx"**6*Y#@9A+@;%9@R	Ta@%2_qC/T[IR	@y?
k.TRHQk).T[
RA 	@?
ka-T|@aAR[,7)Y
YAR4s?(D[ARQY9A;%T[ARqqT|@5TI)a?(yh*C!,a5**РC!ZY9A;%4[@9(Q%q)T_qT[RHHT
_/qTC!x=`4'Z-9W4[KR	@x

@9)JJR)
*?=r;T_qCT[Rlr	@	@y)
JR(*(B4-4[K*R	@y
	@9)JRJJ)
*?=rST8Rc_qkT3@*+uSmSV}@@/R@?qQqT*@?@*@?qTh@THT+@
/@TY9A+@@5?;Mi@*#@;%9T#B}`}_KTq+]T3@
juS+J!
I		T`@iqSi}@(uS2#R@?@+@"@?@R@?h@	#T+@?8TqT
q!T3q
T/@(hiTR@?R@?"R@?(?u)u;k#gTkfTkfT?#q T?q99T@ȉR
r	kqT5(Q4~@B@8KT@)ȍ҉L-	T+@3qTh@B;q#TqTRR@?h00qTbb)@@J_@iT3@h@Y#@ V1	@9A(Tx_q#T[JR	@y?
kaT	a@84_qT@	Iʨ)H	 6Tt4[R=HRȤrT[AR5[AR0[RA+[R1&[RQ!p****9"_q#T[*ȉҊH)	@(?
/T4[RcRr
T[Rq[RA|"*C!,4[(@9/4_[qC'TC!6&4HA!l@99QqTI@)!!yh"*9[_7qT	@?q 'T	@
@9Rk̬r)J)
*	+4	@ꉊRr?
k6T@IhR	ػr	k T9R_qCTHAR@y	k@*T7Ry4[+HR	@y
	@9)JRJJ)
*?=r)T_qI	TРC!`
x4[	@9?qT)%Q?q(T	@8?q)%QT?qCTC!$d[ 54@9Y9AqT%Qqh4T	@8?q)%QT?qCTљY#@9AA@9R	R:q!
[@9?Hq"T?0q9#T?qA$T:q!?)m;!Y9A*HAx8	Q?}q#TqT%QqT[	@BK#	qT*[V
`7Q'kTnH	[j򊉪	A?
T	Aj򪉩?
9'T	@
@9KHRkr)J)
*54	@
@9ψR)r)JkRJJ)
*54	AjQAJC?
8T	A
p*?
`8T	Aꬩ**	?
<TjQ	AAJCJ?
@=T	A	Ҫn
*?
<T	A
j	?
`<TjQ	AAJCJ?
 <T	Aj
Ҫ

?
;T	@
ARr)JRK.rJJ)
*:4	@
A+RMr)JKNR+mrJJ)
*94A)YɊ9A		;%96Td_qcTCAR8RkT(RkT>h	B	@*ʪʬ?
9T8R#@d6H?R	3IR[RY[ARqz**9}!AR|[R!w|#*n.`9U
@96_B'!9!:q7)$9>[	1@9?qT?q T?	qT!>!T&!	,8%@9@#	
@9QAR?q!T[ARY[Ra[AR!/`H!7	*_qCMT[	L4[J:	D9BR!x#?q))#T	q7)"6Y9AHA?A:TJ@@9q Tk%QqT)?
T	diL)
	?;%d[ARY[Ra[AR!<4?H40;*CQqhT	q7)!7l	*2-*.q9TY9AQqTk9=jih8)	
 ֟$\Y9ASqTWq	Tq	TRkT	N:gY#@9AL(`)]9![ARV0m;)=,8q TqT.&?p&<GqT6$*$-$t?
$<0		 7X(@R *!	?!7Y#@9A;%9	&<9@Rd/	&/0Y9A;%h@_	ATOXWW_VgUoT{SC#_֋?#{O89S;i@o	k>/='>~ =AC*	h@_	TOQ{P#_]?#{3sA`@2`a@!2a6
`
@T(A@!p	@{¨#b@()b?#{g_WOW;@59A9A:ZA*6RR 64@*ˠ7@A6T @Cc#CѸ@TH@7@@9
	9@@ `T R0ARN@_	!TOGWF_EgD{C#_?#{WOV;@(A	a@9	@74A@ @sh@9q!
T"`#BR@@94@G@h*7`"2/S\1T@*"&.CBR@@94L*	@7@3@@9Q%qT7*
)@_	ATOEWD@{B#_Rx|0?#{O4A36R@sAi6`@*@`6`@
@7
@@`!h@2	`6_@OA{¨#_a@6m?#{O4A5@AhHR]@+1aTh@5
@OB@{è#Rt9L?#{O4AR R!R9 R;4 Rj-!R0R1aT:7()B-!R0R*4*L(*a
@9OA{¨#Ն?#{g_WOCW;@8A	#A @
}S:ZA9!?=H7BR@@956@7**H@**6*!_d @@9#@@	!TOEWD_CgB{A#_֣?#{O3sAi"@(h}Rh4A"@	qT
@@!:b@
R@
@`OA!0!{¨#<?#{	o
g_W
OCo?RC#K#@4:AZARةr!\RT@R
vH@H@Y(H@TX@N@	)
*j};LJcJKk+8K@
*T41@*5@Y[@*@@@AHR*H@*i~@3몂_	Tji8)qaT9T)T
(2}@(
*(K}@*=l9
(_$(A!)	@?#{og_WOU;ը@)*)A;!@(@9#R@9RCdh}@Fh@6:AZA***?k+TR*774*y8$qTQyqHTkTA@?%#4*kaT@R*k88T(A
@6	(A
@)R	T@C˰9*9**)@@_	ATOGWF_EgDoC{B#_{?#{O89S;h@oJk>+=#>~c\$CR*=h@_	TOQ{P#_L?#{
WOCV;@cѨ>=d5(A	@@_	
TOOWN{M#_RC****CT**'
B}`IE~
HRrAm

HןBm)
3*sAJABa^a^!a^ca^B``)A(a(cb@@jb@9"@b!b`(a@bc@b"7A"b"!]@EF#Ia"B"!?(QC]	
}SrHh9?#{O*	4A@O9OA{¨#_?#C{og_WOJ;H@:ZAH@A@aT}H	 R)r	`TI#@)5;{A7	H@	|@i97Rc9;B"23jT`@j|8c	
5H#@5Hk@96i/i|8"{|4H@#T7C@R*]3sA"o@?Tx23sAR9}H@*	!TCAT	 R)r	TI#@I4I@ @	@9*Q+2_iqi1?qT6H@H7`@j|8cS	 5@@_	aTOHWG_FgEoD{CC#_i/i|8\J
) D?#{O89S;h@oJk>+=#>~ c7=ACR*h@_	TOQ{P#_?#{3sAh
@@5@{¨#_h
@
@?#{g_WOW;@)5)AA3@"@4
@!T@4*#i41T@	Q)8(R@zxcS*y@5*8R7XR4@4(A@!8%m4@F@c6!!RB*!HR*4RqT@_	aTOGWF_EgD{C#_
 )7qR5zR#41T@	Q)8@944*(@8x4RqkT
q+**.*_8N484qaTQqTQiqCTͅQeq	TQ%qT߭qRT߽qT_
k.T́	QRRRM
K
yS!*4qS)8QJ_kKT5
*4_k`T	@*IT'@h7
?#C{og	_
WOH;@))Ao*!@(aAIQi_	q<=T@<**4ДA6)7@!'(RR5*@64Rx7(~`+T~@K
qiR**R\RkT@8!*h*@7	q`kmTRjh89#Q?C1QAT@?T@R@@v5
 )7@ @@_	ATOLWK_JgIoH{GC#_ֆ_$f	@
*
Ju_T*
DiI*t_T	D

D)9PI+j
_.!ʚ-%͚)!ʚJ_񌁇R͡꣉PҋK)A(#<__$&
yI`Q)}S?qT
*je
I}S?qT*JgJ9Pj4KZlE
*˟.!̚-%͚)!̚*R̡PJK飉
H#<_Ae)A_${0~B   _$0B  _$0B"  _$0BB  _$0Bb  _$0B  _$0B  _$0B  _$0B  _$0B  _$0B"  _$0BB  _$0Bb  _$0B  _$0B  _$0B  _$0B  _$0B  _$0B"  _$0BB  _$0Bb  _$0B  _$0B  _$0B  _$0B  _$0B  _$0B"  _$0BB  _$0Bb  _$0B  _$0B  _$0B  _$0B  _$0C  _$0C"  _$0
CB  _$0Cb  _$0C  _$0C  _$0C  _$0C  _$0"C  _$0&C"  _$0*CB  _$0.Cb  _$02C  _$06C  _$0:C  _$0>C  _$0BC  _$0FC"  _$0JCB  _$0NCb  _$0RC  _$0VC  _$0ZC  _$0^C  _$0bC  _$0fC"  _$0jCB  _$0nCb  _$0rC  _$0vC  _$0zC  _$0~C  _$0C  _$0C"  _$0CB  _$0Cb  _$0C  _$0C  _$0C  _$0C  _$0C  _$0C"  _$0CB  _$0Cb  _$0C  _$0C  _$0C  _$0C  _$0C  _$0C"  _$0CB  _$0Cb  _$0C  _$0C  _$0C  _$0C  _$0C  _$0C"  _$0CB  _$0Cb  _$0C  _$0C  _$0C  _$0C  _$0D   _$0D"   _$0
DB   _$0Db   _$0D   _$0D   _$0D   _$0D   _$0"D!  _$0&D"!  _$0*DB!  _$0.Db!  _$02D!  _$06D!  _$0:D!  _$0>D!  _$0BD"  _$0FD""  _$0JDB"  _$0NDb"  _$0RD"  _$0VD"  _$0ZD"  _$0^D"  _$0bD#  _$0fD"#  _$0jDB#  _$0nDb#  _$0rD#  _$0vD#  _$0zD#  _$0~D#  _$0D$  _$0D"$  _$0DB$  _$0Db$  _$0D$  _$0D$  _$0D$  _$0D$  _$0D%  _$0D"%  _$0DB%  _$0Db%  _$0D%  _$0D%  _$0D%  _$0D%  _$0D&  _$0D"&  _$0DB&  _$0Db&  _$0D&  _$0D&  _$0D&  _$0D&  _$0D'  _$0D"'  _$0DB'  _$0Db'  _$0D'  _$0D'  _$0D'  _$0D'  _$0E(  _$0E"(  _$0
EB(  _$0Eb(  _$0E(  _$0E(  _$0E(  _$0E(  _$0"E)  _$0&E")  _$0*EB)  _$0.Eb)  _$02E)  _$06E)  _$0:E)  _$0>E)  _$0BE*  _$0FE"*  _$0JEB*  _$0NEb*  _$0RE*  _$0VE*  _$0ZE*  _$0^E*  _$0bE+  _$0fE"+  _$0jEB+  _$0nEb+  _$0rE+  _$0vE+  _$0zE+  _$0~E+  _$0E,  _$0E",  _$0EB,  _$0Eb,  _$0E,  _$0E,  _$0E,  _$0E,  _$0E-  _$0E"-  _$0EB-  _$0Eb-  _$0E-  _$0E-  _$0E-  _$0E-  _$0E.  _$0E".  _$0EB.  _$0Eb.  _$0E.  _$0E.  _$0E.  _$0E.  _$0E/  _$0E"/  _$0EB/  _$0Eb/  _$0E/  _$0E/  _$0E/  _$0E/  _$0F0  _$0F"0  _$0
FB0  _$0Fb0  _$0F0  _$0F0  _$0F0  _$0F0  _$0"F1  _$0&F"1  _$0*FB1  _$0.Fb1  _$02F1  _$06F1  _$0:F1  _$0>F1  _$0BF2  _$0FF"2  _$0JFB2  _$0NFb2  _$0RF2  _$0VF2  _$0ZF2  _$0^F2  _$0bF3  _$0fF"3  _$0jFB3  _$0nFb3  _$0rF3  _$0vF3  _$0zF3  _$0~F3  _$0F4  _$0F"4  _$0FB4  _$0Fb4  _$0F4  _$0F4  _$0F4  _$0F4  _$0F5  _$0F"5  _$0FB5  _$0Fb5  _$0F5  _$0F5  _$0F5  _$0F5  _$0F6  _$0F"6  _$0FB6  _$0Fb6  _$0F6  _$0F6  _$0F6  _$0F6  _$0F7  _$0F"7  _$0FB7  _$0Fb7  _$0F7  _$0F7  _$0F7  _$0F7  _$0G8  _$0G"8  _$0
GB8  _$0Gb8  _$0G8  _$0G8  _$0G8  _$0G8  _$0"G9  _$0&G"9  _$0*GB9  _$0.Gb9  _$02G9  _$06G9  _$0:G9  _$0>G9  _$0BG:  _$0FG":  _$0JGB:  _$0NGb:  _$0RG:  0y&+e]s(VhnjBLAT.jV2}X?jA?jƱ[K
OY1eq	\DjrznV`r9eMj*̱ͦ+s>s^ǫnȫͫHn	>e
Ce&a
sPy͇rw#ۦUysVԇ2!aNTFSc}eQSin>h#sE=(VjJFS1ur(զ44}iiSKCOSreebW{QnDMh@.S]AChsqsn؇]V8<Cn[X܇	[[?
nS͗Mr| t0@6tE\׬Dv
?WINdkVe`]5$lޝͭ0lѭ\u>0}-{	u-$u#%&X$/e9M:185H]^bo?{g{R\pcLl_X j!`'u!>a"+bXu23X\	Zp:/5g	u0.TlW1Pv34w5{p64e78gUnFck@U{p@\rȭXbX!"Й MI ?@$e@EXlD]pX#v/vüDa{o$̼qlj{u+;Vģϼ؉މxl /|gB@@I@h@ o{ AiAtWvg_vt"Q/qCq6qXlqyScՅ ]]t{~h]bcڣpa~]gcȏΏscl<>D|cs֏qlgClchΎnpY}ũv]vS8hxݼSWAPSPACcNTFSHns_BHRfS_M@VjE=(0^ l|JFS1}44P-ReIsEr4 T d -ReIsEr4Td(rom-nhsqs^m/<XFSB lFAT32RCGFAT16'+c6Y |3^@: nK"3ҔSmWqt_=@s]uf|SKD^ii a@d_AchE@jiI1t
T!hewC@FN PYVqbb1j6ݎu^twk°Ĥmm
h1!d:cClgC	Zmڊnw|w9Z rLJwr?EZ
EwN@IɕLΕ(	\
/`Q``$oo1o'o6op.p8NiGΕkPtd:Qtd>}Rtd
pwpzH}>;ZZ	P}
G
nw^CQRHZdw !#$%w````ӕooɹo	o(ojioo^ouoEooo[}o۹oV/wzS
yi6Z_wxELIFIGIS@_i[xuvgm4r`:~{ebxYZ_Ga_y}ldQ_MqFy}[kxji	
7qx
R
@r@0Z0i 000GA@f_[bLn	n R@rr8rxx @vdxr @uhd~xiq}Xyi   @|d@@=;ys} @"[SAdMbS}ywc^smվ'}ǃЃ ye+fnN6
C
K

^
f
o`5`	oH7oo8Tp,(
o
o(  !   o$o'o8?Xd*A>qOrBs/̧CkDtuvwexEXPާQazeSTuRj{|e}U~wOQoFfE&}<Q@aax
Sb1z'fcbekf8fgh6i"joukI"„#xڄm) o.3/0y%Vu1XPY1ook&	nbINf
2X3h('qAz4;5)u647y8Nbo&cbm`aJXKKzLM	DzZf
 Ȣ
Ѳ]z i	bfo\7u}byo *rGusz@z 	ksf~Iz$l»'@\ ̻ckucAd0 {{voqU.lDyTyz|zz{
{t|
(}}}~~VV}Pn]ܝ܇,l8|Xr\.note.gnu.property.preinit_array.init_array.fini_array.text.got.note.android.ident.got.plt.rela.plt.bss.dynstr.eh_frame_hdr.gnu.version_r.interp.data.rel.ro.relr.dyn.rela.dyn.gnu.version.dynsym.gnu.hash.eh_frame.note.gnu.build-id.dynamic.shstrtab.tdata.rodata.gnu_debugdata.data7zXZִF@!*{ O]?Eh=ڊ"͏$15 b]ě8M*w[4Z6v:[OD߻29i;^Gͩ#Sk4qAcy%K8FS(7yVz=%Ǐ2p6"bFſq]7M\_fvlv2r0&cw(h 8S.ȒwUUT=ý=
Ċl+4/5'BgD"/RGbܹ;kv5XK~)=&-Y7q?F`2'Ro
qsi&-ح_V3[M۳w!֞s2~.A:U5OJ"dS-	{vzBq4SUAEGsɽ°qBc;@Dƞ]tr%Z|t+XC
4ԢjSYmjU?<5%]G5	&>N2*AB;=Wd :[f14wM]@ 7JZ"u*y6Rsp"<>VI#!Lr]
NM|]$2U3U6fR/3._^d8xXYPxp[W_Ad ՔZ;8֭߭ɟ#lj+PܐY*nuL?G$
*XMMy ycG*6ϩp,z
vg㴻
jUHN礙s֭'I		ٻ8^$ue,wBbsmdo~l~ljf˥p-~B	U&n] I]\<zz~J1m#mL'̤
㶨pdg䰛yT],nwr2
i4,nq	FA:Ԗ=C]
hZ463W
n!Ķ
/@TH411u0̂L ZZc&wP
*a4?%GheoSњT}i[mҘ"+A,'Ug>
W<G;
(jQeDҲlWtYd>0pXhA&B'C?:=,-m<[PfJʋv-~KJ|IwF@ԣMc8]޾6mM=FYT\2"{!5$X4/>R_f<\7O}Ms"S?-̉mStn|GzxS١!HttGlIP҉Gnxyk95sH>2:AX:V(:Ssu[eL:RtGdrj\e>zF7wP=[Y'ALJs:ݠkOg0co|n{AMO6ڞ:-\zJ]Kl
p5e>El}d3zNczPvO!Wi7L
<;yӑêDgIk%xU6C=tXj}30)`~e$%ݡؖɺz{ZV`~/C熪 (cV djFr<$zB.6PM(.oi=Z8	4dgVbLrlGBc=e38tg+lJQ*PA"I{iN U'ȨfL (u5>
K)B^Xߤ-y
	%
kTMiĺ)LVJ\jj,papAk1STE* &{6"Q	ԥw\ɘBrK*UK](?QU@v?T$sf ֐n6UK0!XFidjugi Il̿X0nQwip<&2U+>2 5ً4$w\A-N̓sӾ>f*7şsUIn>#ݜbcz' @hku<%=j#>Tm'w(t݉lڙ:&׫p벰th_-b&ahi҂2=#:0/ MSߎ䤒Lh*U,r`׈J
!vnVA+)<:&>1aD'2C@u:-5ccހ]K5m>oP].@ȸq/|঴o
N̉̄%RMk+
՝,r<5o7gDj\<Z[~g*-ݷEƂF}YwEjӃ2}%caGzIlEBY>r]6>1LL<)e}Cn3q¬
HXKPl$+Drq>OB\"&{q@O4=MƒIYomGA߄tM	ME/1R>t2^/N&ٖM?ī^|66(>2S!X$='K{j|m~|g*좿1?Vr]
:		+|{~:e	aQԡts!-95It 㨇>_P!a&PvE>,b*zkI"$Jef
R}ԟQsc8Ob0uHL*'㍊GASd;`ʁz	,pEё\$|wogOn>٥$|WG)Z~6E%"PEbd}v$8-%E˜0~yvv2Qޤ|t~_K4^ꁣcI]RHPDV|H\m@]Dlj,Qv-1C` SC!hǐ
> n%lUc1q)zje;zܵLB!;(4<-#>ҨV)*A?K\(6$SP{ci^zJӕ,4!PpjcJ_1VeXCȡt8GX[upJQTy4\Cxwaa2`_(~U4[(IR?*_yJe#FF`Cβ@>Y\y3
l1{k/ո؁DW(t
f'/C+>_}F9׋Q6%:X5ܼݑ{P2ю88'h遡JĤ)"@D&R{H-2%NQ\@V]țW>j0,6o';̇|F<\D0_djc%+TO5	FZY
.D:&[6|Ů'%4g_@u?ɃĈ}P/+ygOyn6ׯs@K%2X1HA섥pz;5U5p&mHW0Y@߀Ȃҝ֒
aU64S)B)n5(3c.>)/0Wac6KÁ#1&A_nk1W	rr}f-6_͈(Ѡ6",}wd)WYͨe*_mdSpj7N/-tԜhhbȘڬ"
z4$DtDEZB0Tw&V,b(;Wn$Z5_#֫qS3@+"l•oG]^W	L64ܡL_,1d\zJ)xp0ysڇr*fƟzw8;Œ8kI@hތkx<‹\5*kac"ol@u~Y=>!6>~N>[(
:R)1vm-,E#aǦ<1@0,d\AAV,?4S4MjT) gQiWhaoja*oK|-tqϰ+ʪM	ȇu#8g#[Bc3܆9A㞑E22aE4.\s
|
Q2?}c([EE+vNx#3VJݶ͌-n',tٮp7XSʹ,@nK2b17ipu;"ǑE(u']2Tn]SK9,x7lSy
jz_C:azJȰWU0g>I+l$+\.;ccz-'?"-߮!CV6$0]]P"I`Z,2
"ьaӈ;tϡ\n^mFkͅͳzn5r)ia
J"ߊ#p<*HsYƞ(3$ťĿPqr'	V-3XPiR"G|e61@y>V$*0:SsM3/7b]=w;a}b>]òfKv aB&ja; |"gY?`L yaȱHjx"bB"˦WFkWFK'<($8T
_)o#8;T0#Em<܀-R"P[FQkOS(m;/FѫU	lhƪ74݅ȫBpBE7ZzℨNO@|'0Y<IݙLOr9V[z9+6
+OOyaL۹{1C\z7j< K^9ELj)R+c56۟OsXЅȠa(d'QL{kvOZ6t
=Y
S[/%)(`f9_@ }ZX
	YߵLKAQ^o_	]ϑ9`h
ulpVgMΉkZ]fgoƙW?H&
gc@G;{|/WB<ù`2gK/{i&ZB^AˠQHjD[Hۖ!3dKWK1-ՙdUBX{1^rlrDFRB|&Sh+!^pClK,(~l$~!M(j.?: KYUb>Z?Gw-UF2NmIT+epnڔXٝ4\֔<W,ƼcnžO^f'	1Ɏ
x.i节	s$k$9yj1%Gt:=]{?ZP:L:14~fbp',:@௓%קA9OQI/d1Ξ%[*7Gf.ְk"DflڽUTJPe>6;(iaB;I}E1㨳,)3){\-Tdџ5H>VO5<p[a𲢑g,k\v"H~s{N0>Ѽ5,GfkO+f%p9=_N@ >~xT`,evU^AeR꭯[
>{@7uAȇI|ba*#bzM@bD!6d?7_#ȧ\s*dP
޸N
Fm
h1ܝ(3~G5u#^F	4C)-O=s/p{^
*A!)[}wnZ1t_<Ѷ~:9x|d)2ˇ7ȿhb+]%>R9jx삢{
֡mTCTH
,w'oBTrhR(7AgmEXj:L8LG*>wGq@gӏ[AmD2#HaMi6-P@gYZPPFhh  !	o$$o''	o((r,(,(o
`55oH7H7cB882UUzXXL77s;Ih  @  #  /    0 0 0QQP	A`S`SZTT	-n^8)mpB3